Latest update: September 24, 2018


ProGT10.11 (PseG)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.11 (PseG)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepseG 
NCBI Gene ID905604
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePseG 
UniProtKB/ SwissProt IDQ0P8U5
NCBI Ref SeqWP_002830499.1.
UniProtKB Sequence>sp|Q0P8U5|PSEG_CAMJE UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pseG PE=1 SV=1 MKVLFRSDSSSQIGFGHIKRDLVLAKQYSDVSFACLPLEGSLIDEIPYPVYELSSESIYE LINLIKEEKFELLIIDHYGISVDDEKLIKLETGVKILSFDDEIKPHHCDILLNVNAYAKA SDYEGLVPFKCEVRCGFSYALIREEFYQEAKENREKKYDFFICMGGTDIKNLSLQIASEL PKTKIISIATSSSNPNLKKLQKFAKLHNNIRLFIDHENIAKLMNESNKLIISASSLVNEA LLLKANFKAICYVKNQESTATWLAKKGYEVEYKY
EMBL CDSCAL35426.1.
Sequence length274 AA
String192222.Cj1312.
PDB ID (Structural Information)3HBM, 3HBN
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)3.6.1.57
Acceptor Substrate SpecificityUDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose
Experimental ValidationIn vitro
Product2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose
Function in Glycosylation pathway1) PseG hydrolyse UDP-2,4-diacetamido-2,4,6-trideoxy-beta-l-altropyranose to generate 2,4-diacetamido-2,4,6-trideoxy-l-altropyranose.
Litrature
Year Of Validation2009 
Reference Rangarajan, E.S., Proteau, A., Cui, Q., Logan, S.M., Potetinova, Z., Whitfield, D., Purisima, E.O., Cygler, M., Matte, A., Sulea, T. & Schoenhofen, I. C. (2009). Structural and functional analysis of Campylobacter jejuni PseG: a udp-sugar hydrolase from the pseudaminic acid biosynthetic pathway. Journal of Biological Chemistry, jbc-M109.

Authors Rangarajan, E.S., Proteau, A., Cui, Q., Logan, S.M., Potetinova, Z., Whitfield, D., Purisima, E.O., Cygler, M., Matte, A., Sulea, T. & Schoenhofen, I. C.
Research groupsDepartment of Biochemistry, McGill University, Montreal, Quebec H3G 1V6, Canada.
Corresponding Author Schoenhofen, I. C.
ContactsDepartment of Biochemistry, McGill University, Montreal, Quebec H3G 1V6, Canada.