Latest update: September 24, 2018


ProGT10.2 (PglA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.2 (PglA)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepglA 
NCBI Gene ID905416
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePglA 
UniProtKB/ SwissProt IDQ0P9C9
NCBI Ref SeqWP_002852885.1.
UniProtKB Sequence>sp|Q0P9C9|PGLA_CAMJE N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglA PE=1 SV=1 MRIGFLSHAGASIYHFRMPIIKALKDRKDEVFVIVPQDEYTQKLRDLGLKVIVYEFSRAS LNPFVVLKNFFYLAKVLKNLNLDFIQSAAHKSNTFGILAAKWAKIPYRFALVEGLGSFYI DQGFKANLVRFVINSLYKLSFKFAHQFIFVNESNAEFMRNLGLKENKICVIKSVGINLKK FFPIYVESEKKELFWKNLNIDKKPIVLMIARALWHKGVKEFYESATMLKDKANFVLVGGR DENPSCASLEFLNSGAVHYLGARSDIVELLQNCDIFVLPSYKEGFPVSVLEAKACGKAIV VSDCEGCVEAISNAYDGLWAKTKNAKDLSEKISLLLEDEKLRLNLAKNAAQDALQYDENI IAQRYLKLYDRVIKNV
EMBL CDSCAL35242.1.
Sequence length376 AA
String192222.Cj1125c.
Glycosylation Information
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.290
Sugar Donor SpecificityUDP-GalNAc 
Acceptor Substrate SpecificityUndPP-diNAcBac
Experimental ValidationIn vivo and In vitro
ProductUndPP-diNAcBac-GalNAc
Donor SpecificityUDP-GalNAc
Function in Glycosylation pathway1) PglA is a GalNAc transferase and adds the first GalNAc residues to the Campylobacter jejuni glycan.
Additional Information1) PglA is very specific enzyme other than Und-PP-Bac, it also accepts Und-PP-6-hydroxybacillosamine and Und-PP-GlcNAc to lesser extents.  
Litrature
Year Of Validation2005 
Reference Glover, K. J., Weerapana, E., & Imperiali, B. (2005). In vitro assembly of the undecaprenylpyrophosphate-linked heptasaccharide for prokaryotic N-linked glycosylation. Proceedings of the National Academy of Sciences, 102(40), 14255-14259.

Authors Glover, K. J., Weerapana, E., & Imperiali, B.
Research groupsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139
Corresponding Author Imperiali, B.
ContactsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139
Reference Glover, K. J., Weerapana, E., & Imperiali, B. (2005). In vitro assembly of the undecaprenylpyrophosphate-linked heptasaccharide for prokaryotic N-linked glycosylation. Proceedings of the National Academy of Sciences, 102(40), 14255-14259.

Authors Glover, K. J., Weerapana, E., & Imperiali, B.
Research groupsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139
Corresponding Author Szymanski, C. M.
ContactsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139