Latest update: September 24, 2018


ProGT10.4 (PglI)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.4 (PglI)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepglI 
NCBI Gene ID905419
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePglI 
UniProtKB/ SwissProt IDQ0P9C6
NCBI Ref SeqWP_002852770.1.
UniProtKB Sequence>sp|Q0P9C6|PGLI_CAMJE GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglI PE=1 SV=1 MPKLSVIVPTFNRQVLLEKAIKSIQNQDFKDLEIIVSDDNSSDDTKSVVQNLQKDDDRIK YFLNQNYKQGPNGNKNNGLDQASGEFVTFLDDDDELLSGALSTLMQKANEGYAHVFGNCL IEKEGNLSKEFSGKGLEKDSEISKKDFLMAKFSGEFFSVFKKSLLENKRFNEEFYGNEAT LWVNLYKEKSFYIHKAFRIYRIFRQDSVTLGASKNAYRVYLGYLELAKILENELRMSKDK DYKKTCASYYKMAAYYAKLAKNYKALYKCLFKSLSIKINAPALILLILSIIPNNMIEKLS KIRVALCKN
EMBL CDSCAL35245.1.
Sequence length309 AA
Subcellular LocationMembrane (Integral component of membrane)
String192222.Cj1128c.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.293
Sugar Donor SpecificityUDP-Glc 
Experimental ValidationIn vitro
Donor SpecificityUDP-Glc
Function in Glycosylation pathway1) PglI function as a beta-1,-3 glucosyltransferase and responsible for the addition of the final branching glucose to complete the heptasaccharide biosynthesis.
Litrature
Year Of Validation2005 
Reference Glover, K. J., Weerapana, E., & Imperiali, B. (2005). In vitro assembly of the undecaprenylpyrophosphate-linked heptasaccharide for prokaryotic N-linked glycosylation. Proceedings of the National Academy of Sciences, 102(40), 14255-14259.

Authors Glover, K. J., Weerapana, E., & Imperiali, B.
Research groupsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02140
Corresponding Author Imperiali, B.
ContactsDepartments of Chemistry and Biology, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02140
Reference Reid, C. W., Stupak, J., Chen, M. M., Imperiali, B., Li, J., & Szymanski, C. M. (2008). Affinity-capture tandem mass spectrometric characterization of polyprenyl-linked oligosaccharides: tool to study protein N-glycosylation pathways. Analytical chemistry, 80(14), 5468-5475.

Authors Reid, C. W., Stupak, J., Chen, M. M., Imperiali, B., Li, J., & Szymanski, C. M.
Research groupsNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.
Corresponding Author Imperiali, B.
ContactsNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.
Reference Kelly, J., Jarrell, H., Millar, L., Tessier, L., Fiori, L.M., Lau, P.C., Allan, B. & Szymanski, C. M.(2006). Biosynthesis of the N-linked glycan in Campylobacter jejuni and addition onto protein through block transfer. Journal of bacteriology, 188(7), 2427-2434.

Authors Kelly, J., Jarrell, H., Millar, L., Tessier, L., Fiori, L.M., Lau, P.C., Allan, B. & Szymanski, C. M.
Research groupsInstitute for Biological Sciences, National Research Council, 100 Sussex Dr., Ottawa, Ontario K1A 0R6, Canada
Corresponding AuthorSzymanski, C. M.
ContactsInstitute for Biological Sciences, National Research Council, 100 Sussex Dr., Ottawa, Ontario K1A 0R6, Canada