Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT10.5 (PglE)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.5 (PglE)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepglE 
NCBI Gene ID905412
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePglE 
UniProtKB/ SwissProt IDQ0P9D3
NCBI Ref SeqWP_002852877.1.
UniProtKB Sequence>sp|Q0P9D3|PGLE_CAMJE UDP-N-acetylbacillosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglE PE=1 SV=1 MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKAYSKSENALALNSATAAL HLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECE KKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSFYKNKALGTFGEFGAYSY NGNKIITTSGGGMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA QMEVLEQRVLKKREIYEWYKEFLGECFSFLDELENSRSNRWLSTALIDFDKNELNSCQKD INISQKNITLHPKISKLIEDLKNEQIETRPLWKAMHAQEVFKGAKAYLNGNSELFFQKGI CLPSGTAMSKDDVYEISKLILKSIKA
EMBL CDSCAL35238.1.
Sequence length386 AA
String192222.Cj1121c.
PDB ID (Structural Information)4ZTC
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)2.6.1.34
Acceptor Substrate SpecificityUDP-HexNAc
Experimental ValidationIn vitro
ProductUDP-2-acetamido-4-keto-2,4,6-trideoxy-d-glucose
Function in Glycosylation pathway1) PglE is an aminotransferase involved in the bacillosamine biosynthesis pathway.
Litrature
Year Of Validation2006 
Reference Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M. (2005). Functional characterization of dehydratase/aminotransferase pairs from Helicobacter and Campylobacter: enzymes distinguishing the pseudaminic acid and bacillosamine biosynthetic pathways. Journal of Biological Chemistry.

Authors Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M.
Research groupsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada
Corresponding Author Logan, S. M.
ContactsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada
Reference Olivier, N. B., Chen, M. M., Behr, J. R., & Imperiali, B. (2006). In vitro biosynthesis of UDP-N, N ‘-diacetylbacillosamine by enzymes of the Campylobacter jejuni general protein glycosylation system. Biochemistry, 45(45), 13659-13669.

Authors Olivier, N. B., Chen, M. M., Behr, J. R., & Imperiali, B.
Research groupsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.
Corresponding Author Logan, S. M.
ContactsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.