Latest update: September 24, 2018


ProGT10.6 (PglF)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.6 (PglF)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepglF 
NCBI Gene ID905411
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePglF 
UniProtKB/ SwissProt IDQ0P9D4
NCBI Ref SeqWP_002858054.1.
UniProtKB Sequence>sp|Q0P9D4|PGLF_CAMJE UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglF PE=1 SV=1 MIFYKSKRLAFFLTSDIVLILLSVYLAFSLRFSGDIPSIFYHGMMVSAIILLVLKLSFLF VFRIYKVAWRFFSLNEARKIFIALLLAEFCFFLIFYFFSDFFNPFPRSAIVIDFVLSYMF IGTLRISKRMLVDFKPSRMKEEETPCIVVGATSKALHLLKGAKEGSLGLFPVGVVDARKE LIGTYCDKFIVEEKEKIKSYVEQGVKTAIIALRLEQEELKKLFEELVAYGICDVKIFSFT RNEARDISIEDLLARKPKDLDDSAVAAFLKDKVVLVSGAGGTIGSELCKQCIKFGAKHLI MVDHSEYNLYKINDDLNLYKEKITPILLSILDKQSLDEVLKTYKPELILHAAAYKHVPLC EQNPHSAVINNILGTKILCDSAKENKVAKFVMISTDKAVRPTNIMGCTKRVCELYTLSMS DENFEVACVRFGNVLGSSGSVIPKFKAQIANNEPLTLTHPDIVRYFMLVAEAVQLVLQAG AIAKGGELFVLDMGKPVKIIDLAKKMLLLSNRNDLEIKITGLRKGEKLYEELLIDENDAK TQYESIFVAKNEKVDLDWLNKEIENLQICEDISEALLKIVPEFKHNKEGV
EMBL CDSCAL35237.1.
Sequence length590 AA
Subcellular LocationMembrane (Integral component of membrane)
String192222.Cj1120c.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)4.2.1.135
Acceptor Substrate SpecificityUDP-HexNAc
Experimental ValidationIn vitro
ProductUDP-4-keto-sugar
Function in Glycosylation pathway1) PglF has C6 dehydratase activity, utilize UDP-GlcNAc and convert it into UDP-4-keto-sugar, the substrate of PglE in the prokaryotic glycoprotein N-linked heptasaccharide biosynthesis pathway.
Litrature
Year Of Validation2006 
Reference Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M. (2005). Functional characterization of dehydratase/aminotransferase pairs from Helicobacter and Campylobacter: enzymes distinguishing the pseudaminic acid and bacillosamine biosynthetic pathways. Journal of Biological Chemistry.

Authors Schoenhofen, I.C., McNally, D.J., Vinogradov, E., Whitfield, D., Young, M., Dick, S., Wakarchuk, W.W., Brisson, J.R. & Logan, S. M.
Research groupsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada
Corresponding Author Logan, S. M.
ContactsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada
Reference Olivier, N. B., Chen, M. M., Behr, J. R., & Imperiali, B. (2006). In vitro biosynthesis of UDP-N, N ‘-diacetylbacillosamine by enzymes of the Campylobacter jejuni general protein glycosylation system. Biochemistry, 45(45), 13659-13669.

Authors Olivier, N. B., Chen, M. M., Behr, J. R., & Imperiali, B.
Research groupsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.
Corresponding Author Young, N. M.
ContactsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.
Reference Riegert, A. S., Young, N. M., Watson, D. C., Thoden, J. B., & Holden, H. M. (2015). Structure of the external aldimine form of PglE, an aminotransferase required for N, N?diacetylbacillosamine biosynthesis. Protein Science, 24(10), 1609-1616.

Authors Riegert, A. S., Young, N. M., Watson, D. C., Thoden, J. B., & Holden, H. M.
Research groups1 Department of Biochemistry, University of Wisconsin, Madison, Wisconsin, 53706. 2 Human Health Therapeutics, National Research Council Canada, Ottawa, Ontario, Canada, K1A OR6
Corresponding Author Holden, H. M.
ContactsDepartment of Biochemistry, University of Wisconsin, Madison, Wisconsin.