Latest update: September 24, 2018


ProGT10.7 (PglC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.7 (PglC)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepglC 
NCBI Gene ID905415
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePglC 
UniProtKB/ SwissProt IDQ0P9D0
NCBI Ref SeqWP_002852766.1.
UniProtKB Sequence>sp|Q0P9D0|PGLC_CAMJE Undecaprenyl phosphate N,N'-diacetylbacillosamine 1-phosphate transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglC PE=1 SV=1 MYEKVFKRIFDFILALVLLVLFSPVILITALLLKITQGSVIFTQNRPGLDEKIFKIYKFK TMSDERDEKGELLSDELRLKAFGKIVRSLSLDELLQLFNVLKGDMSFVGPRPLLVEYLPL YNKEQKLRHKVRPGITGWAQVNGRNAISWQKKFELDVYYVKNISFLLDLKIMFLTALKVL KRSGVSKEGHVTTEKFNGKN
EMBL CDSCAL35241.1.
Sequence length200 AA
Subcellular LocationMembrane (Integral component of membrane)
String192222.Cj1124c.
Glycosylation Information
EC Number (BRENDA)2.7.8.36
Sugar Donor SpecificityUDP-2-acetamido-4-keto-2,4,6-trideoxy-d-glucose 
Acceptor Substrate SpecificityUndPP
ProductUndPP-diNAcBac
Donor SpecificityUDP-2-acetamido-4-keto-2,4,6-trideoxy-d-glucose
Function in Glycosylation pathway1) PglC is a glycosyl-1-phosphate transferase, required for the first step in the formation of an undecaprenyl-linked heptasaccharide donor in Campylobacter jejuni, it catalyzes the transfer of bacillosamine phosphate to undecaprenyl phosphate to form Und-PP-Bac.
Litrature
Year Of Validation2006 
Reference Glover, K. J., Weerapana, E., Chen, M. M., & Imperiali, B. (2006). Direct biochemical evidence for the utilization of UDP-bacillosamine by PglC, an essential glycosyl-1-phosphate transferase in the Campylobacter jejuni N-linked glycosylation pathway. Biochemistry, 45(16), 5343-5350.

Authors Glover, K. J., Weerapana, E., Chen, M. M., & Imperiali, B.
Research groupsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.
Corresponding Author Imperiali, B.
ContactsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.
Reference Glover, K. J., Weerapana, E., Chen, M. M., & Imperiali, B. (2006). Direct biochemical evidence for the utilization of UDP-bacillosamine by PglC, an essential glycosyl-1-phosphate transferase in the Campylobacter jejuni N-linked glycosylation pathway. Biochemistry, 45(16), 5343-5350.

Authors Glover, K. J., Weerapana, E., Chen, M. M., & Imperiali, B.
Research groupsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.
Corresponding Author Szymanski, C. M.
ContactsDepartment of Chemistry, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139, USA.