Latest update: September 24, 2018


ProGT10.9 (PglK)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT10.9 (PglK)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)192222
Genome Information
Gene BankAL111168
EMBLAL111168
Gene Information
Gene NamepglK 
NCBI Gene ID905421
NCBI Reference SequenceNC_002163.1.
Protein information
Protein NamePglK 
UniProtKB/ SwissProt IDQ0P9C4
NCBI Ref SeqWP_002858308.1.
UniProtKB Sequence>sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 MLKKLFFILSKEDKNFLFFLLVFSVFISFIETFAISLVMPFITLASDFSYFDRNKYLISL KEYLNIPVFEIIVYFGVGLIVFYVFRALLNAYYFHLLARFSKGRYHAIAYKVFSKFLNIN YEKFTQKNQSEILKSITGEVYNLSTMISSFLLLMSEIFVVLLLYALMLLINYKITLFLSI FMVLNAFILVKILSPIIKKAGVRREEAMKNFFEILNTNLNNFKFIKLKTKEDGVLSLFKA QSEAFSKANITNESVAAVPRIYLEGIGFCVLVFIVVFLVLKNESDISGILSTISIFVLAL YRLMPSANRIITSYHDLLYYHSSLDIIYQNLRQEEENLGEEKLSFNQELKICNLSFGYEG KKYLFKNLNLNIKKGEKIAFIGESGCGKSTLVDLIIGLLKPKEGQILIDEQELNANNTKN YRQKIGYIPQNIYLFNDSIAKNITFGDAVDEEKLNRVIKQANLEHFIKNLPQGVQTKVGD GGSNLSGGQKQRIAIARALYLEPEMLVLDEATSALDTQSEAKIMDEIYKISKDKTMIIIA HRLSTITQCDKVYRLEHGKLKEEK
EMBL CDSCAL35247.1.
Sequence length564 AA
Subcellular LocationMembrane (Inner membrane)
String192222.Cj1130c.
PDB ID (Structural Information)5C73, 5C76, 5C78
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)3.6.3.39
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Act as a flippase.
Litrature
Year Of Validation2006 
Reference Reid, C. W., Stupak, J., Chen, M. M., Imperiali, B., Li, J., & Szymanski, C. M. (2008). Affinity-capture tandem mass spectrometric characterization of polyprenyl-linked oligosaccharides: tool to study protein N-glycosylation pathways. Analytical chemistry, 80(14), 5468-5475.

Authors Reid, C. W., Stupak, J., Chen, M. M., Imperiali, B., Li, J., & Szymanski, C. M.
Research groupsNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.
Corresponding Author Szymanski, C. M.
ContactsNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.
Reference Kelly, J., Jarrell, H., Millar, L., Tessier, L., Fiori, L.M., Lau, P.C., Allan, B. & Szymanski, C. M. (2006). Biosynthesis of the N-linked glycan in Campylobacter jejuni and addition onto protein through block transfer. Journal of bacteriology, 188(7), 2427-2434.

Authors Kelly, J., Jarrell, H., Millar, L., Tessier, L., Fiori, L.M., Lau, P.C., Allan, B. & Szymanski, C. M.
Research groupsNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.
Corresponding Author Szymanski, C. M.
ContactsNational Research Council, Institute for Biological Sciences, 100 Sussex Drive, Ottawa, ON, Canada, K1A 0R6.