Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT115.1 (GT2)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT115.1 (GT2)
Organism Information
Organism NameClostridium difficile R20291
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)645463
Genome Information
Gene BankFN545816
EMBLFN545816
Gene Information
Gene NameCDR20291_0242 
Protein information
Protein NameGT2 
UniProtKB/ SwissProt IDC9YI49
NCBI Ref SeqCBE01879
UniProtKB Sequence>tr|C9YI49|C9YI49_PEPDR Glycosyl transferase family 2 OS=Peptoclostridium difficile (strain R20291) GN=CDR20291_0242 PE=4 SV=1 MNTPIVVNEKSKDIIKDWQYTYTNEDIKFTSIIILTYNQIEYTKLCIESIRKFTPKNKYE IIIIDNNSSDGTVEWLKGQSDIKSVYNNKNLGFPKGCNQGIELATGENILLLNNDVIVTP NWLYNLNKALWSQDNIGAVGPITNACSYYQQIDVDYKSIEDMFMFAHKINTSNINLWKYR LKLVGFCMLIKKSVLDNVGVLDELFTPGNFEDDDLSFRMLESGYKLLLCQDTFIHHFGSV SFKENRNKYTDIMYINRRKFETKWGFNPEYSGMIRTDLISKIDDSLEANINVLEIGCGIG ATLLEIKNIYKNASIYGIEISESAGKLAKYSADVLIADIEKVKLDYEKDFFDYIILGDVL EHLTDPWKIVNELKQYLKKDGCLISSIPNIMHVSVLRNLVLGNFTYEDSGILDKTHLRFF TLNEITKMFNDSNYIINSVTATSMPLSEIDNRFIDTMCKESCKEMRQQYESYQYIVKATK SIDTKRYSSISMVNLKYALMRIDNELDVDSNLSYIFDNYNITEPCFVDDIEYLVDTFVIN KATLLNRLGVEAFNRGLGDFSINMFMTVLEMDRDDIDSIYNITSVLCELEEFDTAYNLIK NSSKKVQSESDIQDILYFIEGKRYE
EMBL CDSCBE01879.1
Sequence length625 AA
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Additional Information1) GT2 is responsible for extension of glycans on flagellar protein by transferring two rhamnose moieties.
2) GT2 is also responsible for methylation of the rhamnoses. 
Litrature
Year Of Validation2016 
Reference Valiente, E., Bouché, L., Hitchen, P., Faulds-Pain, A., Songane, M., Dawson, L.F., Donahue, E., Stabler, R.A., Panico, M., Morris, H.R. & Bajaj-Elliott, M. (2016). Role of glycosyltransferases modifying type B flagellin of emerging hypervirulent Clostridium difficile lineages and their impact on motility and biofilm formation. Journal of Biological Chemistry, jbc-M116.

Authors Valiente, E., Bouché, L., Hitchen, P., Faulds-Pain, A., Songane, M., Dawson, L.F., Donahue, E., Stabler, R.A., Panico, M., Morris, H.R. & Bajaj-Elliott, M.
Research groups1 Department of Pathogen Molecular Biology, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT, United Kingdom. 2 Department of Life Sciences, Imperial College London, South Kensington Campus, London SW7 2AZ, United Kingdom. 3 Institute of Child Health, University College London, 30 Guilford Street, London WC1N 1EH, United Kingdom. 4 BioPharmaSpec Ltd., Suite 3.1, Lido Medical Centre, St. Saviours Road, Jersey JE2 7LA, United Kingdom. 5 Vaccine Program, Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario K1A 0R6, Canada.
Corresponding Author Bajaj-Elliott, M.
ContactsDepartment of Pathogen Molecular Biology, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT, United Kingdom.