Latest update: September 24, 2018


ProGT115.2 (GT3)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT115.2 (GT3)
ProGT Pathway
Organism Information
Organism NameClostridium difficile R20291
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)645463
Genome Information
Gene BankFN545816
EMBLFN545816
Gene Information
Gene NameCDR20291_0243 
Protein information
Protein NameGT3 
UniProtKB/ SwissProt IDC9YI50
NCBI Ref SeqCBE01881
UniProtKB Sequence>tr|C9YI50|C9YI50_PEPDR Glycosyl transferase, group 2 family OS=Peptoclostridium difficile (strain R20291) GN=CDR20291_0243 PE=4 SV=1 MNNDKICFITCVNDERLYEECLVYINSLDIPKNFSIETVALRGADSIASAYNKAMRETDS KYKVYLHQDAFIINKNFIYDILEIFKKNTDVGMIGVAGVKDIPVNGIWWDSDKKAGKVYD SHTGKMDIYEFSNFEECFNEVMAIDGLIMITQYDVFWREDKFDGWHFYDLSQSMEFRQNK YKVIVPKQNKPWCMHDSGVANINNGYDEYRIKFVKEYINLDLYRENFYEFDKKKASTILK SNKHVMDCMKEELTEQLRLKNYKDVLDIVSKIAHFSVFNHTGLYSCEKCERALLECANNL PEIENTKLFTKKDLKRRKVLHVLSEGYSTGGHTRLVKNWIEIDKDSVHSVVTTWQSDTLP DWLLKAIDDSGGEVISLDLISDDYLKRAVALRKIAYDWADIVILYVHMWDTIPVVAFGVD GKIPILHVNHYDSTFWLGTSIADIVIDFSEASQLITLDKRGIDKSEILPMPLKEKEVFSK SEVRKRYNLEDDVTIILTIASERKYNSVNDINYFKIAKTLIENTDNTIIIVVGVDTENLY WKTLSNVTDNRVICFGTTANIDDFYKISDIYLESFMVGSHTSKLDAILYDLIPVKFKNEV SPIFTNMWNFIDKFDYKNIKEVIDMIRRYNTSEFDRDKIKEKQSEIKHFVIDKHCIEIKN YIDKIYKEANHHKVKYDLYKNDEIEDYQLFVALYGYMVKNKNMS
EMBL CDSCBE01881.1.
Sequence length704 AA
Glycosylation Information
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Additional Information1) GT3 is responsible the for the transfer of novel sulfonated peptidyl-amido sugar moiety. 
Litrature
Year Of Validation2016 
Reference Valiente, E., Bouché, L., Hitchen, P., Faulds-Pain, A., Songane, M., Dawson, L.F., Donahue, E., Stabler, R.A., Panico, M., Morris, H.R. & Bajaj-Elliott, M. (2016). Role of glycosyltransferases modifying type B flagellin of emerging hypervirulent Clostridium difficile lineages and their impact on motility and biofilm formation. Journal of Biological Chemistry, jbc-M116.

Authors Valiente, E., Bouché, L., Hitchen, P., Faulds-Pain, A., Songane, M., Dawson, L.F., Donahue, E., Stabler, R.A., Panico, M., Morris, H.R. & Bajaj-Elliott, M.
Research groups1 Department of Pathogen Molecular Biology, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT, United Kingdom. 2 Department of Life Sciences, Imperial College London, South Kensington Campus, London SW7 2AZ, United Kingdom. 3 Institute of Child Health, University College London, 30 Guilford Street, London WC1N 1EH, United Kingdom. 4 BioPharmaSpec Ltd., Suite 3.1, Lido Medical Centre, St. Saviours Road, Jersey JE2 7LA, United Kingdom. 5 Vaccine Program, Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario K1A 0R6, Canada.
Corresponding Author Bajaj-Elliott, M.
ContactsDepartment of Pathogen Molecular Biology, London School of Hygiene and Tropical Medicine, Keppel Street, London WC1E 7HT, United Kingdom.