Latest update: September 24, 2018


ProGT13.1 (GlmS)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.1 (GlmS)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameglmS 
NCBI Gene ID2762284
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameGlucosamine-6-phosphate synthase (GlmS) 
UniProtKB/ SwissProt IDQ6LWM9
NCBI Ref SeqWP_048064125.1.
UniProtKB Sequence>sp|Q6LWM9|GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) GN=glmS PE=1 SV=2 MCGIIGYIGNEKASKILLKGLKRLEYRGYDSCGIATIDDTIKLKKNTGKVLEVSKKENFE DMTGFIGIGHSRWATHGGITKNNAHPHYDCSEKICIAHNGIISNYKELKELLISKGHIFK SETDTEVIPHLIEEEIKDFKEITEKTYINAIQNTIKKLNGTYALLILNQDFPEMLVGVRN ESPLILGIKKDECFIGSDISAFLEYTKLAMPLNDRDIVILRKENDEIDIEVLNYGKQVQR DTIELQWDMESAEKEGYEHFMLKEIMEEPVILKNSMKISKLEIENLGKEIEKCDKIYITA MGTSLHAAMVAEYWFSGLNKLVIPIDSSEFLTKGIVDEKTLVIAITQSGETYDTMKAVKY AKEKGAKTATIVNVLGSTATREADITIMMGSGLEIAVCATKTFMSQLVILYRLFIEYGKI IGKNMDIFEKELLNIPNYISKVLDEKENISKIAEELTAKNYLFISKGINLANALEGALKF KEITYLHAEGMSSGFLKHGTISLIDENMDTVALIPPSKSELLNSVLSNVEEIKARNGKII GISPVEDNLKYSIKVPDVIEEVSPFVYATACQLLAYYKAVDLKRDVDKPRGLAKSVTVE
EMBL CDSCAF31236.1.
Sequence length599 AA
Subcellular LocationCytoplasm
String267377.MMP1680.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)2.6.1.16
Acceptor Substrate SpecificityFructose-6-phosphate
Experimental ValidationIn vitro
ProductGlcN-6-P
Function in Glycosylation pathway1) It helps in catalyzing the isomerization and transamidation of Fru-6-Phosphate to form GlcN-6-Phosphate.
Litrature
Year Of Validation2008 
Reference Namboori, S. C., & Graham, D. E. (2008). Acetamido sugar biosynthesis in the Euryarchaea. Journal of bacteriology, 190(8), 2987-2996.

Authors Namboori, S. C., & Graham, D. E.
Research groupsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA
Corresponding Author Graham, D. E.
ContactsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA