Latest update: September 24, 2018


ProGT13.10 (AglX)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.10 (AglX)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglX  
NCBI Gene ID2762567
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglX  
UniProtKB/ SwissProt IDQ6LYB0
NCBI Ref SeqWP_011171025.1
UniProtKB Sequence>tr|Q6LYB0|Q6LYB0_METMP Putative LPS biosynthesis protein WbpG OS=Methanococcus maripaludis (strain S2 / LL) GN=wbpG PE=4 SV=1 MVQKICKRCIMDMTDPNIVFDENGYCNHCYNALEQNSKIKVNMAEKNKELKKIVNLIKKN GKNKRYDCIIGVSGGVDSTYVAYLVKKLGLKPLAVHLDNGWNSELAIMNIENTLKKLDID LYTRVLNWEEFKDLQLSFLKASVPDLEIPTDHAIIATLYEVAHKFGIKYIISGHNIITES IGVPMWSNGHYDWKYISGLQKKFGNIKLLDYPKMTPLNIFYYQFIKDIKMIRILNYADYD KKRVVELIEKEFSWKDYPTKHGESIYTHFIQSYILPEKFGYDKRKCHLSNLICSEQITRA EALGQFKKPLFTPQELEELINYSCDKLEISRKEFESLMKLPNKSYYDYPSYENSKFYKFL RETYKKIRVY
EMBL CDSCAF30637.1.
Sequence length370 AA
Subcellular LocationCytoplasm
String267377.MMP1081.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Function as N-acetyl sugar amidotransferases.
Additional Information1) Deletion in MMP1081 result in truncated glycan missing the terminal sugar with threonine and acetamidino group to the third sugar.  
Litrature
Year Of Validation2012 
Reference Jones, G.M., Wu, J., Ding, Y., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F. (2012). Identification of genes involved in the acetamidino group modification of the flagellin N-linked glycan of Methanococcus maripaludis. Journal of bacteriology, JB-06686.

Authors Jones, G.M., Wu, J., Ding, Y., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada