Latest update: September 24, 2018


ProGT13.11 (AglY)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.11 (AglY)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglY 
NCBI Gene ID2761201
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglY 
UniProtKB/ SwissProt IDP61783
NCBI Ref SeqWP_011171026.1.
UniProtKB Sequence>sp|P61783|HIS52_METMP Imidazole glycerol phosphate synthase subunit HisH 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=hisH2 PE=3 SV=1 MIAIIDYGMGNVGSIKNMIAKIGFDAIITNDPELISKATKLILPGVGSFDSGMTNLKELG LIDILNKKVVQEKTPLLGICLGMHLLTNSSEEGRLKGLGFINAKTVKFKLSNKFKIPHMG WNYVKFSIKNKLSDNLIENSRFYFVHSYYVICEDKKNILMTTEYENEFTSAVSKDNIYGV QFHPEKSHKFGMKLMENFIKQA
EMBL CDSCAF30638.1.
Sequence length202 AA
Subcellular LocationCytoplasm
String267377.MMP1082.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It has a glutaminase activity.
Litrature
Year Of Validation2012 
Reference Jones, G.M., Wu, J., Ding, Y., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F. (2012). Identification of genes involved in the acetamidino group modification of the flagellin N-linked glycan of Methanococcus maripaludis. Journal of bacteriology, JB-06686.

Authors Jones, G.M., Wu, J., Ding, Y., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada