Latest update: September 24, 2018


ProGT13.13 (AglU)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.13 (AglU)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglU 
NCBI Gene ID2761478
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglU 
UniProtKB/ SwissProt IDQ6LYA7
NCBI Ref SeqWP_011171028.1.
UniProtKB Sequence>tr|Q6LYA7|Q6LYA7_METMP Uncharacterized protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1084 PE=4 SV=1 MPEIYLEYYKNTKMGGFKSFKPNFKFYVPHKLFKKFSEKYIIYFYDFDWKKDSVIKKDLN AHGLDKIHENINNIQISILNGEILPKKKRFNPEDTENIEYGAFNIVNIDENTIKIYNDIF SMVPMYYYMDNDIFIVSTKMKPIIERLNSLSKTLTEDNVGKYFSASCGYLIGNYTFFEEI KYIRPGRKITINLENNKVTFSRYYTYKYTKKYKQESIKESDFMELFNIFDKSQDILLKNY SENTGLLISGGLDSRYIIAQMEKLYIYPKLLNMGHKNSSETNLAIKVSKLSNNIGNLTIN ELTEDNIIKNAEEYYNVNEGFENFECDYLLDFKNWAIKNNVHYLYNGYAGDAVVGGTFYT RRNFDLASICDQIIDLKDLIHEIKTKEDCINLILKNLGIHKEKILKEKYKDFKEINLRKI VENEINNIMDEITYETYLDVYIHFQYLTRVYRHVLNGCLATRSFSEFIHPFFAYKMFETS LTVDDRLKTQHHIYKKYLIDRFPKYAKINKSGWGVNCYNSAKVCKFGEYYEAFKNKLINL VNNKFEKPLIKMDTYYDATYWYYNSEEFRNFLKNDLKNGFMDKHIEYIEKYYDIKYK
EMBL CDSCAF30640.1.
Sequence length597 AA
String267377.MMP1084.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It has a glutamine amidotransferase activity.
Litrature
Year Of Validation2013 
Reference Ding, Y., Jones, G.M., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F. (2013). Identification of genes involved in the biosynthesis of the third and fourth sugars of the Methanococcus maripaludis archaellin N-linked tetrasaccharide. Journal of bacteriology, JB-00668.

Authors Ding, Y., Jones, G.M., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F.
Research groupsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.