Latest update: September 24, 2018


ProGT13.14 (AglV)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.14 (AglV)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglV 
NCBI Gene ID2762454
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglV 
UniProtKB/ SwissProt IDQ6LYA6
NCBI Ref SeqWP_011171029.1.
UniProtKB Sequence>tr|Q6LYA6|Q6LYA6_METMP Uncharacterized protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1085 PE=4 SV=1 MDVSGEFMKTNTWLNYKHDYLLHACTGKKVLHIGATDYPYHEERAKKGILLHQKLNKVAN VTGLDISKDAIKTLKENGINNIFYGDIVKNKYDKHIISQKFDIIIFPDVIEHLSKPGCAL ENLKQFCSNETRIIITAPNVWSITELKNHFRKNENVHPDHCFWTSTTTLKKLCEFSGYSV KGIIYTNSGASDDKITFKGKIFRNIIDKFPHMRNVLILEINSNR
EMBL CDSCAF30641.1.
Sequence length224 AA
String267377.MMP1085.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is a S-adenosylmethionine (SAM)-dependent methyltransferase.
Additional Information1) MMP1085 deletion result in truncated N-glycan with missing methyl group O-linked to the C5 hydroxyl group on the unique fourth sugar residue. 
Litrature
Year Of Validation2013 
Reference Ding, Y., Jones, G.M., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F. (2013). Identification of genes involved in the biosynthesis of the third and fourth sugars of the Methanococcus maripaludis archaellin N-linked tetrasaccharide. Journal of bacteriology, JB-00668.

Authors Ding, Y., Jones, G.M., Uchida, K., Aizawa, S.I., Robotham, A., Logan, S.M., Kelly, J. & Jarrell, K. F.
Research groupsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.