Latest update: September 24, 2018


ProGT13.16 (Agl19)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.16 (Agl19)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene Nameagl19 
NCBI Gene ID2762080
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAgl19 
UniProtKB/ SwissProt IDQ6M0B9
NCBI Ref SeqWP_011170296.1.
UniProtKB Sequence>sp|Q6M0B9|UGNO_METMP UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0352 PE=1 SV=1 MLKVAVVGIGVMGYNHARIYNELQKDGNVELVGLSDMNKDRLNEVSEEFGVKAFSNYMDL LEEDLDAVSIVVPTFLHKEVALPFIKKGISVLIEKPIADTIENANEIIAEAEKNNVILSV GHVERFNPAVLKLKEHVEKGNLGDIVTMTAKRVGPMTTRIADAGVILDLAVHDIDVMAFL ANSKVKHVHALAKNVKHPNNNAEDYALIISSFENSIDGIIEVNRLTPHKTRTLNIVGTKG IAYLDYMNQDLTLYDEEWVKTAKINKEEPLKKEIAHFVDCVQNNKQPLVTGLDGLNALET AIYALKSSNGN
EMBL CDSCAF29908.1.
Sequence length311 AA
String267377.MMP0352.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)1.1.1.374
Experimental ValidationIn vivo
Additional Information1) Agl18 (MMP0351), Agl19 (MMP0352), and Agl20 (MMP0353) are involved in the synthesis of the UDP-GlcNAc3NAcA from UDP-GlcNAc, the second sugar of N-linked tetrasaccharide.
2) It homolog to WbpE of P. aeruginosa PAO1 and can functionally replace it.  
Litrature
Year Of Validation2015 
Reference Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F. (2015). Evidence that biosynthesis of the second and third sugars of the archaellin tetrasaccharide in the archaeon Methanococcus maripaludis occurs by the same pathway used by Pseudomonas aeruginosa to make a di-N-acetylated sugar. Journal of bacteriology, JB-00040.

Authors Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F.
Research groups2 Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada. 2 Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario, Canada. 3 Department of Life Sciences, Prefectural University of Hiroshimahobara, Hiroshima, Japan. 4Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada jarrellk@queensu.caL
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.