Latest update: September 24, 2018


ProGT13.17 (Agl20)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.17 (Agl20)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene Nameagl20 
NCBI Gene ID2761983
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAgl20 
UniProtKB/ SwissProt IDQ6M0B8
NCBI Ref SeqWP_011170297.1.
UniProtKB Sequence>tr|Q6M0B8|Q6M0B8_METMP UDP-glucose/GDP-mannose dehydrogenase Related protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0353 PE=3 SV=1 MNELGNLKIAVFGQGKMGLPLASVFAEYGINVIGVDINQMVVDNLNNGINHITEEPGLSE LVSKNVENKKYTATTDGVGAATDADIIVILVPTLIDDRGNIKLDPVYSVSEIISKGLKKG NIVITEATMPPGTTEKLIPILEKSGLKLGEFGLAHAPERTMTGTALRDIKGQYPKIIGCS DERTHNIVSKLYDLINKKGTIKMSSIKAAETVKVFEGVYRDVNIGLSNEMALWCEEHSIN ALEVFEAANTQPFCHFHTPGAGVGGHCIPVYPWFVINTSNEVNPRITKTARELNDYMAHH IVELTIKGLNEFKKCLNGSKILVLGLTFRGGVKEFMKSAAIPIINELNSLGANVYSYDPL CDELDAKKYNSKLKTDFNGIDAIIVTSDHEEFKHLDFEKISKEVSTKLIVDGRNIINVSN ATENGFRVIKVGNLK
EMBL CDSCAF29909.1
Sequence length495 AA
String267377.MMP0353.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Additional Information1) Agl18 (MMP0351), Agl19 (MMP0352), and Agl20 (MMP0353) are involved in the synthesis of the UDP-GlcNAc3NAcA from UDP-GlcNAc, the second sugar of N-linked tetrasaccharide.
2) It homolog to WbpE of P. aeruginosa PAO1 and can functionally replace it. 
Litrature
Year Of Validation2015 
Reference Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F. (2015). Evidence that biosynthesis of the second and third sugars of the archaellin tetrasaccharide in the archaeon Methanococcus maripaludis occurs by the same pathway used by Pseudomonas aeruginosa to make a di-N-acetylated sugar. Journal of bacteriology, JB-00040.

Authors Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F.
Research groups3 Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada. 2 Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario, Canada. 3 Department of Life Sciences, Prefectural University of Hiroshimahobara, Hiroshima, Japan. 4Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada jarrellk@queensu.caL
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.