Latest update: September 24, 2018


ProGT13.18 (Agl21)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.18 (Agl21)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene Nameagl21 
NCBI Gene ID2761372
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAgl21 
UniProtKB/ SwissProt IDQ6M0B4
NCBI Ref SeqWP_011170301.1.
UniProtKB Sequence>sp|Q6M0B4|WECBH_METMP UDP-N-acetylglucosamine 2-epimerase homolog OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0357 PE=1 SV=1 MKIVTIVGARPQFIKLAPVSKEIRRHFEEIIIHTGQHYDFEMDKIFFDELEIPTPNYNLN IGSGSHGFQTGEMLKKIEEILLKEKPDLVLVYGDTNSTIAGALAGSKLNIKIAHVEAGLR SFDRKMPEEINRVLTDHISNILFTPTETADINLKNEGINSGIFNVGDVMYDSLLNALKLI EKKNFKILDELNISKKKYILATVHRAENTDIKENLENIINAFIESNEKIIFPVHPRTRKY LEKYRLFEKIKNYDNLKLISPVGYLEMIYLENNAKKILTDSGGVQKEAYFLKVPCVTLRN NTEWVETVLDGWNILVGSNKEKILENISKFNPASETYNYRFGEGNSSVKIVEVLRNL
EMBL CDSCAF29913.1.
Sequence length357 AA
String267377.MMP0357.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Additional Information1) ?mmp0357 mutant suggested that mmp0357 encoding Agl21 protein is involved in the biosynthesis of the third sugar (ManNAc3NAmA6Thr). 
Litrature
Year Of Validation2015 
Reference Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F. (2015). Evidence that biosynthesis of the second and third sugars of the archaellin tetrasaccharide in the archaeon Methanococcus maripaludis occurs by the same pathway used by Pseudomonas aeruginosa to make a di-N-acetylated sugar. Journal of bacteriology, JB-00040.

Authors Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F.
Research groups1 Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada. 2 Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario, Canada. 3 Department of Life Sciences, Prefectural University of Hiroshimahobara, Hiroshima, Japan. 4 Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.