Latest Update: Feb 22, 2019 (ProGlycProt is registered as partner website of GlyTouCan, the International Glycan Structure Repository)


ProGT13.19 (AglW)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.19 (AglW)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglW 
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglW 
UniProtKB/ SwissProt IDQ6LYA1
UniProtKB Sequence>tr|Q6LYA1|Q6LYA1_METMP UDP-glucose 4-epimerase related OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1090 PE=4 SV=1 MIKKYTYYFIFGEILKILVTGGAGFIGSHIVDMLIENGHDVSILDNLSTGNEKNLNSSAK FINGDILDKNLDLTGFECVIHEAAQINVRTSVENPSLDANINILGTVNILEKMKEYGVKK IIFSSSGGAVYGEPEYLPVDEKHSLKPLSPYGLSKFCAEEYIKLYNMLYDIEYCILRYSN VYGERQDPLGEAGVISIFIDKMKKGEVPVIYGDGNQTRDFVNVKDVARANLMALNWKNEI VNIGSGKETSVNELFKIISSEIGFDKDPIYKKEREGEVYKIYIDYSKAKSLGWMPEVELD DGIKKI
EMBL CDSCAF30646.1.
Sequence length306 AA
Subcellular LocationMembrane (Integral component of membrane)
String267377.MMP1090.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is UDP-glucose 4-epimerase.
Additional Information1) Deletion in MMP1090 result in truncated N-glycan missing the terminal sugar residue and the threonine attached to the third sugar.  
Litrature
Year Of Validation2016 
Reference Ding, Y., Jones, G.M., Brimacombe, C., Uchida, K., Aizawa, S.I., Logan, S.M., Kelly, J.F. & Jarrell, K. F. (2016). Identification of a gene involved in the biosynthesis pathway of the terminal sugar of the archaellin N-linked tetrasaccharide in Methanococcus maripaludis. Antonie van Leeuwenhoek, 109(1), 131-148.

Authors Ding, Y., Jones, G.M., Brimacombe, C., Uchida, K., Aizawa, S.I., Logan, S.M., Kelly, J.F. & Jarrell, K. F.
Research groups1 Department of Biomedical and Molecular Sciences, Queens University, Kingston, K7L 3N6, Canada. 2 Department of Life Sciences, Prefectural University of Hiroshima, Shobara, Hiroshima, 727-0023, Japan. 3 Human Health Therapeutics Portfolio, National Research Council, Ottawa, K1A 0R6, Canada. 1 Department of Biomedical and Molecular Sciences, Queens University, Kingston, K7L 3N6, Canada. 2 Department of Life Sciences, Prefectural University of Hiroshima, Shobara, Hiroshima, 727-0023, Japan. 3 Human Health Therapeutics Portfolio, National Research Council, Ottawa, K1A 0R6, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.