Latest update: September 24, 2018


ProGT13.2 (GlmM)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.2 (GlmM)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameglmM 
NCBI Gene ID2762645
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NamePhosphoglucosamine mutase (GlmM) 
UniProtKB/ SwissProt IDQ6LYB4
NCBI Ref SeqWP_011171021.1.
UniProtKB Sequence>sp|Q6LYB4|GLMM_METMP Phosphoglucosamine mutase OS=Methanococcus maripaludis (strain S2 / LL) GN=glmM PE=1 SV=1 MKLFGTSGIRMKNLDPLIAYKVGFAISKNFKKAVIGRDTRTTGNLIESAITAGLLNGGCD VTTIGMVPTPVLGYSAKDYDLGIMITASHNPPEYNGIKLFNKNGTAFDPKQEKELENIIN NDDFNECTWDNIGCVVEDKTAVKKYFEYILQNLNLNTNFNVVVDCANAAGCVVSPNIFTE AGCKVISVNSHCDGRFVGRMPEPNETNLKETVDIIKGLNSNGRNYVGIAHDGDADRMIAI DELGRVTDFDKLLAAFCKYLVQKTGADKIVTTVDASMAIEEYLNEFGAKVIRTKIGDVAV AEELEKTGAIFGGEPSGTWIHRDIHLTPDGILSGLRVLEMMEFYGKKLHEIIDEVPSYCN MREKISCPDNLKQNVMDYVSKEGEKIFEKKPETLDGVRFSFENGWILIRPSGTESYVRVR VEAKEKDFAEKLMKTGISMVKTGISGK
EMBL CDSCAF30633.1.
Sequence length447 AA
Subcellular LocationCytoplasm
String267377.MMP1077.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)5.4.2.10
Acceptor Substrate SpecificityGlcN-6-P
Experimental ValidationIn vitro
ProductGlcN-1-P
Function in Glycosylation pathway1) It is a glucosamine phosphomutases and mediates conversion of GlcN-6-P to GlcN-1-P.
Litrature
Year Of Validation2008 
Reference Namboori, S. C., & Graham, D. E. (2008). Acetamido sugar biosynthesis in the Euryarchaea. Journal of bacteriology, 190(8), 2987-2996.

Authors Namboori, S. C., & Graham, D. E.
Research groupsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA
Corresponding Author Graham, D. E.
ContactsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA