Latest update: September 24, 2018


ProGT13.3 (WecB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.3 (WecB)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NamewecB 
NCBI Gene ID2761897
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameWecB 
UniProtKB/ SwissProt IDQ6LZC4
NCBI Ref SeqWP_011170649.1.
UniProtKB Sequence>sp|Q6LZC4|WECB_METMP UDP-N-acetylglucosamine 2-epimerase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecB PE=1 SV=1 MYKIGIILGTRPEIIKMSPVIRELTTKKFFLIHTNQHYSENMDKIFFEELNLKKPDYNLN IGSGSHGDQTGRMLMEIEKVLLKEKPDFVLVQGDTNTVLAGALAASKLGIKIGHIEAGLR SFDRKMPEETNRVLTDHISEFLFAPTKTAANNILKEGISDEKIHIVGNTIVDATIQNLKI AEKNEKVCKFISKITKNEKYFLLTLHRAENTDNFEILSKLVTSINNISKKYEKNIIFPIH PRTHKKLNEFGLINKLENNHLIKIIEPVGYLEFLGLEKNAELIITDSGGLQEEACILNVP CVTLRENTERPETLDVNSNILAGSDPENILNCVEKMLKSNRHWNNPFGDGNSGKIIVNIV FGEKKP
EMBL CDSCAF30261.1.
Sequence length366 AA
Subcellular LocationCytoplasm
String267377.MMP0705.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)5.1.3.14
Acceptor Substrate SpecificityUDP-GlcNAc
Experimental ValidationIn vitro
ProductUDP-ManNAc
Function in Glycosylation pathway1) The UDP-GlcNAc 2-epimerase catalyzes the isomerization of UDP-GlcNAc to produce UDP-ManNAc.
Additional Information1) The M. maripaludis WecB protein shares 36% amino acid identity with the E. coli UDP-GlcNAc 2-epimerase protein WecB, which is required for enterobacterial common-antigen biosynthesis. 
Litrature
Year Of Validation2008 
Reference Namboori, S. C., & Graham, D. E. (2008). Acetamido sugar biosynthesis in the Euryarchaea. Journal of bacteriology, 190(8), 2987-2996.

Authors Namboori, S. C., & Graham, D. E.
Research groupsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA
Corresponding Author Graham, D. E.
ContactsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA