Latest update: September 24, 2018


ProGT13.4 (WecC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.4 (WecC)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NamewecC 
NCBI Gene ID2761881
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameWecC 
UniProtKB/ SwissProt IDQ6LZC3
NCBI Ref SeqWP_011170650.1.
UniProtKB Sequence>sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 MEKHGDYDIKKICVIGLGYIGLPTASMLANHGYDVVGVDVNEKRVNQIKNGELKIEEPGL LTLVKGAINSKNLNVRTSATEADAFIICVPTPALAKEDGSKKCDLSYVMSAVEAILPFVK DGNLIVIESTIPPETTKKIYETLNKKIYVAHCPERVLPGKILKELVENDRIIGGINKKSA EMAKEIYKSFVEGQIYTTDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIK IANKHPRVNILNPGPGVGGHCISIDPWFIVEKTNNAKFIRAARELNDNMPAYVCNSVLSE LKKLGIEKPKISIFGATYKGNVEDTRESPSKNVIKMLLENGATVSTYDPHASYFEYPLST LDECISGSDCIVVLTDHDVFKTIKKDDIDEICPKLKNKIVFDTKNILEHSLWKKAGFTVK LLGNGAW
EMBL CDSCAF30262.1.
Sequence length427 AA
String267377.MMP0706.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)1.1.1.336
Acceptor Substrate SpecificityUDP-ManNAc
Experimental ValidationIn vitro
ProductUDP-ManNAcA
Function in Glycosylation pathway1) This protein used NAD(+) to oxidizing UDP-N-acetylmannosamine and form UDP-N-acetylmannosaminuronate (ManNAcA).
Litrature
Year Of Validation2008 
Reference Namboori, S. C., & Graham, D. E. (2008). Acetamido sugar biosynthesis in the Euryarchaea. Journal of bacteriology, 190(8), 2987-2996.

Authors Namboori, S. C., & Graham, D. E.
Research groupsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA
Corresponding Author Graham, D. E.
ContactsInstitute for Cellular and Molecular Biology, University of Texas at Austin, Austin, Texas 78712, USA