Latest update: September 24, 2018


ProGT13.5 (AglO)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.5 (AglO)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglO 
NCBI Gene ID2761168
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglO 
UniProtKB/ SwissProt IDQ6LYB2
NCBI Ref SeqWP_011171023.1.
UniProtKB Sequence>tr|Q6LYB2|Q6LYB2_METMP Glycosyl transferase, family 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1079 PE=4 SV=1 MSEKPLISVLMPNYNSEKYLNEAIESILNQTYENFEFIILDDCSTDNSWKIIQEYAKKDK RINIFRNEKNLGRPKTYNRLLNMISNESFFFFFMGSDDVVKENMINIKLNYFNNFEEIDG IGNSIEYVDENLNFIKKREYPLTDRDIRKNFLIFNPISQGGMCLKSNLKNETFNEKYKVC LDYEIWTRLIDKGYTFENLKESLYLYRQQREQAKQKNLKMTLVNTVKIKSKYLFRPQYFS INAFLRFNLEILLLMLPKKLILWVFYKSL
EMBL CDSCAF30635.1.
Sequence length269 AA
String267377.MMP1079.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityGlcNAc3NAcA 
Acceptor Substrate SpecificityGalNAc
Experimental ValidationIn vivo
Donor SpecificityGlcNAc3NAcA
Function in Glycosylation pathway1) AglO (MMP1079) carried out the transfer GlcNAc3NAcA to the flagellin glycan (GalNAc).
Additional Information  
Litrature
Year Of Validation2009 
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.