Latest update: September 24, 2018


ProGT13.6 (AglA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.6 (AglA)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglA 
NCBI Gene ID25392614
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglA 
UniProtKB/ SwissProt IDQ6LYB1
NCBI Ref SeqWP_011171024.1
UniProtKB Sequence>tr|Q6LYB1|Q6LYB1_METMP Glycosyl transferase, group 1 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1080 PE=4 SV=1 MKKVLMILSNGFNPDPRVYKEAKSLVDIGFKVSIICWDRECNLKIRENIDGIEVYRVRTG KVISGNVKSMLCNIFKFHKKVFNLAKTVQFDAVHAHDFDTVRVGNKLKKKFKVPLIYDIH DLYESYLRNNKFLKIIIRNLDIFYCKKADLIIIVNDSFKMRPQIKGRKTVLLMNTPLLRG NVFSKNTKEGIFYAGGLQESRKMDFVFEANKELNQRVTIAGDGPLLEEYMKEYDSNLNTF LGRIPAKDVEEKTKNCKLIIAPYDPFYLNNRLASPNKLFEAMKYGKPSLVSEGTVMGDIV KKERCGETFRYGDIEDFIEKCNLIEKNYDFYALNAYSAFKNKYSWDFMINNLFKEYGVLL NIDI
EMBL CDSCAF30636.1.
Sequence length364 AA
String267377.MMP1080.
Glycosylation Information
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityManNAc3NAmA 
Acceptor Substrate SpecificityGlcNAc3NAcA
Experimental ValidationIn vivo
Donor SpecificityManNAc3NAmA
Function in Glycosylation pathway1) AglA (MMP1080) is responsible for adding ManNAc3NAmA to the flagellar glycan (GlcNAc3NAcA).
Litrature
Year Of Validation2009 
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.