Latest update: September 24, 2018


ProGT13.7 (AglL)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.7 (AglL)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglL 
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglL 
UniProtKB/ SwissProt IDQ6LYA3
UniProtKB Sequence>tr|Q6LYA3|Q6LYA3_METMP Glycosyl transferase, group 1 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1088 PE=4 SV=1 MNVFKTLVRKMNELTEKTLLVLTPCYPDKRGKVVGDPFVKYPVDEMKRFFKEIIVISPQP YFPSLLTKFKFFRNRFTASNVFQDYSYENVTVFYPKFFTLPMTPFRKRNGDYCYNASKRI LKKNNLKFDLIHAHFTWPCGYVAAKLKKEHKKKVVLTGHGFDIYELPFRNKFWNKKATDV LKKVDKIITVSESNKKCIKVLGFNSIVLTNGFNSKKFKFLKNKKGLKSELNIPPNKKIIL HVGNLIKIKNQINIINAANELQKKRKDFVVYLIGAGPDKEKIINKIKKLKLEDHVKVLGP KTHDEIPLWMNIADLFVLPSYSEGNPTVMFEALGCGLPFIGTNVGGVSEIITSEEYGLLY NDPEDYHILTELINRGLNKKWNNEKITNYSKEFTWKKISKRIINIYNDIS
EMBL CDSCAF30644.1.
Sequence length410 AA
String267377.MMP1088.
Glycosylation Information
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Function as a glycosyltransferase.
Additional Information1) MMP1088 probably responsible for the addition of the fourth monosaccharide to the flagellar glycan. 
Litrature
Year Of Validation2009 
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.