Latest update: September 24, 2018


ProGT13.8 (AglH)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.8 (AglH)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene NameaglH 
NCBI Gene ID2761328
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAglH 
UniProtKB/ SwissProt IDQ6LXC9
NCBI Ref SeqWP_011171367.1.
UniProtKB Sequence>tr|Q6LXC9|Q6LXC9_METMP Putative glycosyl transferase, family 4:Aldehyde dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1423 PE=4 SV=1 MDLYFVLSALFCFVISLIFTKFMIKKMVNYKYGYDLHKADKIKVAEMGGLSPVVVSSVVM LFFNPALSLSIFLPGFVGVIDDISRLNSKEKIVLTFLIGFPVAFFLKLGFLPSILLILGI FVSSNLTNMLAGFNGLEIGMGILLCLFMAVVCLMNGDIFGFKVLILFLAAYLGLLYYNRY PAKVFPGDTGTLPIGAFLATIAVWRGFIPELFILMIPFMVDALLKQFTAGVTKKDSVFTP TQLKNGKLCVEGGYLSLPRMILMKKAMEEYKIVLVLWAIEAFFGILSILYTKYFGFNIF
EMBL CDSCAF30979.1.
Sequence length299 AA
Subcellular LocationMembrane (Integral component of membrane)
String267377.MMP1423.
Glycosylation Information
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Function as a glycosyltransferase.
Litrature
Year Of Validation2009 
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada.