Latest update: September 24, 2018


ProGT13.9 (Agl17)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT13.9 (Agl17)
Organism Information
Organism NameMethanococcus maripaludis (strain S2 / LL)
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)267377
Genome Information
Gene BankBX950229
EMBLBX950229
Gene Information
Gene Nameagl17  
NCBI Gene ID2761256
NCBI Reference SequenceNC_005791.1.
Protein information
Protein NameAgl17  
UniProtKB/ SwissProt IDQ6M0C1
NCBI Ref SeqWP_011170294.1.
UniProtKB Sequence>tr|Q6M0C1|Q6M0C1_METMP Bacterial transferase hexapeptide repeat OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0350 PE=4 SV=1 MGSYQAHPTAHVENNSKIGDNTRIWHFSHIRENSEIGKNCNLGKGVYIDTNVKIGNNVKI QNNVSVYAGVEVEDDVFLGPHMVFTNDLYPRAFNNNWKIVRTKVKTGASIGANSTVVCGI TIGNYAMIGSGSVVTKDVPDYALVYGNPARLNGFVCTCGKKLENMVEKTEKLVKYRCSNC STIVEIKKEDHDLLGD
EMBL CDSCAF29906.1.
Sequence length196 AA
Subcellular LocationCytoplasm
String267377.MMP0350.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is a acetyltransferase.
Additional Information1) It work with MMP0351, MMP0352, and MMP0353 these are all involved in the biosynthesis of the second sugar (GlcNAc3NAcA) of the archaellin tetrasaccharide i.e to convert UDP-GlcNAc to UDP-GlcNAc3NAcA.
2) It is a homolog to WbpD of P. aeruginosa PAO1 and can functionally replace it.  
Litrature
Year Of Validation2008 
Reference VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F. (2009). Identification of genes involved in the assembly and attachment of a novel flagellin N?linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Molecular microbiology, 72(3), 633-644.

Authors VanDyke, D. J., Wu, J., Logan, S. M., Kelly, J. F., Mizuno, S., Aizawa, S. I., & Jarrell, K. F.
Research groupsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.
Reference Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F. (2015). Evidence that biosynthesis of the second and third sugars of the archaellin tetrasaccharide in the archaeon Methanococcus maripaludis occurs by the same pathway used by Pseudomonas aeruginosa to make a di-N-acetylated sugar. Journal of bacteriology, JB-00040.

Authors Siu, S., Robotham, A., Logan, S. M., Kelly, J. F., Uchida, K., Aizawa, S. I., & Jarrell, K. F.
Research groups1 Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada. 2 Human Health Therapeutics Portfolio, National Research Council, Ottawa, Ontario, Canada. 3 Department of Life Sciences, Prefectural University of Hiroshima, Shobara, Hiroshima, Japan. 4 Department of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada jarrellk@queensu.ca
Corresponding Author Jarrell, K. F.
ContactsDepartment of Biomedical and Molecular Sciences, Queens University, Kingston, Ontario, Canada.