Latest update: September 24, 2018


ProGT15.1 (AglD)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.1 (AglD)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglD 
NCBI Gene ID8924085
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglD 
UniProtKB/ SwissProt IDD4GUA0
NCBI Ref SeqWP_004044138.1.
UniProtKB Sequence>sp|D4GUA0|AGLD_HALVD Glycosyltransferase AglD OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglD PE=1 SV=1 MGRPTERRPAAATAAGVEVSVVLPAYNEARTIENTVRVTVETLESFLPADAFEVIVAEDG CDDETPEIADRLAAEDDRIRHYHSDDRLGRGGALERAFEAARGDTLVYFDTDLATDMRHL EELVERVRSGEYDAATGSRWMPDRVADRPRKRGVPSRAYNGLVRLFLRSDLRDHQCGFKA FSREAFEALRDDVEDNHWFWDTEMLVRAQRAGFRVAEFPVDWEPKGDTKVDLVRDILGMG SQILRTWWQLTVRPRITRRVTIVAGLLLTVLALALMTLYIDPSEVISVLGDADPALVAAA AVIYVVSWPLRGIRYREILRELGYREKAGFLTGAIFISQTGNLVFPARAGDAVRAYVVKA RRNIPYPSGFASLAVERVFDLLTIAGLAGVVLVGLAATGGLDDIATVLATGVSGGSVDVS ADDVRTAAYVATGVGVVAILGVLGIALSARADRNVVRAFVGRFSSDSYVELVAGVIEQFV SDLQAVAGNRAAFGRVGLTSLAIWTVDVVTAVVVLLALGVDIDPVVLVGVSFFAVSVGNL AKVLPLSPGGVGLYEIAFTVFMAALAPVTPAAALAAAVLDHAVKNAVTIVGGVGSMLSLN VSLTTAVEESAEVRDREHELADSK
EMBL CDSCAM91696.1.
Sequence length324 AA
Subcellular LocationMembrane (Integral component of membrane)
String309800.HVO_0798.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityUDP-hexuronic acid 
Acceptor Substrate SpecificityDolichol phosphate-linked trisaccharide
Experimental ValidationIn vivo
ProductDolichol phosphate-hexose
Donor SpecificityUDP-hexuronic acid
Function in Glycosylation pathway1) AglD transfer hexose subunit to form the pentasaccharide.
Litrature
Year Of Validation2006 
Reference Abu-Qarn, M., Yurist-Doutsch, S., Giordano, A., Trauner, A., Morris, H.R., Hitchen, P., Medalia, O., Dell, A. & Eichler, J. (2007). Haloferax volcanii AglB and AglD are involved in N-glycosylation of the S-layer glycoprotein and proper assembly of the surface layer. Journal of molecular biology, 374(5), 1224-1236.

Authors Abu-Qarn, M., Yurist-Doutsch, S., Giordano, A., Trauner, A., Morris, H.R., Hitchen, P., Medalia, O., Dell, A. & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Reference Abu-Qarn, M., Yurist-Doutsch, S., Giordano, A., Trauner, A., Morris, H.R., Hitchen, P., Medalia, O., Dell, A. & Eichler, J. (2007). Haloferax volcanii AglB and AglD are involved in N-glycosylation of the S-layer glycoprotein and proper assembly of the surface layer. Journal of molecular biology, 374(5), 1224-1236.

Authors Abu-Qarn, M., Yurist-Doutsch, S., Giordano, A., Trauner, A., Morris, H.R., Hitchen, P., Medalia, O., Dell, A. & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.