Latest update: September 24, 2018


ProGT15.10 (AglR)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.10 (AglR)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglR 
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglR 
UniProtKB/ SwissProt IDD4GYG8
UniProtKB Sequence>sp|D4GYG8|AGLR_HALVD Probable flippase AglR OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglR PE=1 SV=1 MAKLARASALQFGANVTQTFVGAIITIYVINELGVGAFGIFALSAALVKWASIPAVGIRG AVITRMNESDDISPSEYFTTASVLTGAIILVGLLALLGYSPFVEQYLDYSGTQLVGGMFV SNVSFRLVLGGLRGENRVEMSSLYEALWGILSSLVKLALVYTGVGVDALFYGEITSSIVI GIFGVYSLNISFVSPTRSAAISLYSWARYGWLDNLKRMSYSWLDTIILGFFVSTSLVGIY EVAWRISALFVLLPTAISKSTFPTISSLRDTDKLNKVRRILTRGLSVAGVLAIPGLVGSV LVGGDILALYGPSVSSVGVAVSVLVSLSVVRLVECYETLVMQALNALDLPDRTFRIGVIF ITTNIILNVSLIPMFGVIGAAIATLLSMTLGSILAVRALPKAVQTLPPVSAIGSQFVSAG AMAVVLFTILNYRPIGQPIEVVLYVLAGATTYGFVLLSLSSNFRERVQQLLSESLG
EMBL CDSCAW30729.1.
Sequence length411 AA
Subcellular LocationMembrane (Integral component of membrane)
String309800.HVO_1524.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Probably involved in the translocation of the dolichol-phosphate-mannose across the membrane.
Litrature
Year Of Validation2013 
Reference Kaminski, L., Guan, Z., Abu-Qarn, M., Konrad, Z., & Eichler, J. (2012). AglR is required for addition of the final mannose residue of the N-linked glycan decorating the Haloferax volcanii S-layer glycoprotein. Biochimica et Biophysica Acta (BBA)-General Subjects, 1820(10), 1664-1670.

Authors Kaminski, L., Guan, Z., Abu-Qarn, M., Konrad, Z., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.