Latest update: September 24, 2018


ProGT15.13 (Agl7)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.13 (Agl7)
ProGT Pathway
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene Nameagl7 
NCBI Gene ID8926286
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAgl7 
UniProtKB/ SwissProt IDD4GU60
NCBI Ref SeqWP_004041932.1.
UniProtKB Sequence>sp|D4GU60|AGL7_HALVD Low-salt glycan biosynthesis sulfotransferase Agl7 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl7 PE=3 SV=1 MITGPISNLSGESGFENVFIFISDSLRYDALPERIRSKGLTIKTIAAAPWTASSIPSLMS GKYPSSHNVWMFEDRLPQRPPLLSEQEDWDAGFDSEKHWLKFESSEKPPVKMLRLDGEQK LADIEPPFVHVVHDLGPHAPYGFENDEYETGPYFRDYNDPKDLQQKYQNDAEKSANYFLE ILDKLENLGLREDTLCVFTSDHGELLGEGGRLGGKWGHSTPLCPELLEVPMTFIGKGIPK GETLSGVASGVDLAPTCLSAVGREIGHVDGIDLWAETPDEDRRVRSDVWQRYNAFGRELP VYVASGLWDNDGGWVKHRRSKLLRMAYYGYDVFLGDYAPPARSTTGISELVSGLKFWGRD WEKFGNTTISLQEAQKELSDELVRSEDSVELSEEQTEHLEALGYV
EMBL CDSADE02348.1.
Sequence length405 AA
String309800.HVO_2046.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) Agl7 is responsible for the sulfation of lipid-linked sugar.
Additional Information1) Deletion of agl7 gene resulted in a nonsulfated version of the low-salt tetrasaccharide added to the S-layer glycoprotein. 
Litrature
Year Of Validation2013 
Reference Kaminski, L., Guan, Z., Yurist-Doutsch, S., & Eichler, J. (2013). Two distinct N-glycosylation pathways process the Haloferax volcanii S-layer glycoprotein upon changes in environmental salinity. MBio, 4(6), e00716-13.

Authors Kaminski, L., Guan, Z., Yurist-Doutsch, S., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.