Latest update: September 24, 2018


ProGT15.22 (AglQ)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.22 (AglQ)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglQ 
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglQ 
UniProtKB/ SwissProt IDD4GYG6
UniProtKB Sequence>sp|D4GYG6|AGLQ_HALVD Archaeal glycosylation protein Q OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglQ PE=1 SV=1 MTSLSDILASSAEAGLSLQRSDGSMPAGHNGPYHDPETPVRNTSHWLVTFLKAHELTDEN RFRQAASDAVSYLLSEEARPHGHTFEHRQNDTKDRCNGLMGQAWSLEALALAARALDNER AAAVAADVFLSHPFCDKLKLWQRVDTDGTILGFDRTFNHQLWFAASGGLVAHTAPQEVSQ RVRDFLDSLPSTIDLYENGLIRHPLRPSMDLSELAESVTHDVHRSMVRNHLLHYLRPPRS KRRLRNKAEGYHSFNLYALAILAREFPSHSVWSTDLLSDILEYTLSEEFREATTDNKFSH PYNPPGFEVPAAMETFSVGSYKEREMWVNEQIQHSFDPNTSLLTRGTDDKQTHAARLYEA TRLDDYEIYLD
EMBL CDSCAW30728.1.
Sequence length371 AA
Subcellular LocationCytoplasm
String309800.HVO_1523.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It is epimerase/isomerase.
Additional Information1) AglQ might be responsible for the appearance of the methyl ester of hexuronic acid found at position four of the pentasaccharide N-linked to the S-layer glycoprotein. 
Litrature
Year Of Validation2013 
Reference Arbiv, A., Yurist-Doutsch, S., Guan, Z., & Eichler, J. (2013). AglQ is a novel component of the Haloferax volcanii N-glycosylation pathway. PLoS One, 8(11), e81782.

Authors Arbiv, A., Yurist-Doutsch, S., Guan, Z., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Reference Arbiv, A., Yurist-Doutsch, S., Guan, Z., & Eichler, J. (2013). AglQ is a novel component of the Haloferax volcanii N-glycosylation pathway. PLoS One, 8(11), e81782.

Authors Arbiv, A., Yurist-Doutsch, S., Guan, Z., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Imperiali, B.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.