Latest update: September 24, 2018


ProGT15.3 (AglF)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.3 (AglF)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglF 
NCBI Gene ID8924609
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglF 
UniProtKB/ SwissProt IDD4GYH1
NCBI Ref SeqWP_004041405.1.
UniProtKB Sequence>sp|D4GYH1|AGLF_HALVD UTP--glucose-1-phosphate uridylyltransferase AglF OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglF PE=1 SV=1 MQAVVLAAGKGTRLRPLTEDKPKGMVEVDGKPILTHCFDQLVDLGAEKLVVVVGYKKEII IQHYDDEYRGVPITYAHQREQKGLAHALLTVEDHIDEDFMLMLGDNIFNANLGDVVKRQR EDRADAAFLVEEVDWDEASRYGVCVTNDYGEITEVIEKPEEPPSNLVMTGFYTFTPAIFH ACHLVQPSNRGEYEISEAIDLLIRSGRTIDAIRIDGWRLDIGYPEDRDEAEQRLQEETTQ ATE
EMBL CDSCAQ51229.1.
Sequence length243 AA
String309800.HVO_1527.
Glycosylation Information
CAZY FamilyNon-GT
Acceptor Substrate SpecificityGlucose-1-phosphate
Experimental ValidationIn vivo
ProductUDP-Glc
Function in Glycosylation pathway1) AglF is glucose-1-phosphate uridyltransferase, involved in the biosynthesis of UDP-glucose from glucose-1-phosphate and UTP.
Litrature
Year Of Validation2008 
Reference Yurist?Doutsch, S., Abu?Qarn, M., Battaglia, F., Morris, H. R., Hitchen, P. G., Dell, A., & Eichler, J. (2008). aglF, aglG and aglI, novel members of a gene island involved in the N?glycosylation of the Haloferax volcanii S?layer glycoprotein. Molecular microbiology, 69(5), 1234-1245.

Authors Yurist?Doutsch, S., Abu?Qarn, M., Battaglia, F., Morris, H. R., Hitchen, P. G., Dell, A., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Reference Yurist?Doutsch, S., Magidovich, H., Ventura, V. V., Hitchen, P. G., Dell, A., & Eichler, J. (2010). N?glycosylation in Archaea: on the coordinated actions of Haloferax volcanii AglF and AglM. Molecular microbiology, 75(4), 1047-1058.

Authors Yurist?Doutsch, S., Magidovich, H., Ventura, V. V., Hitchen, P. G., Dell, A., & Eichler, J.
Research groupsDepartment of Chemistry, Massachusetts Institute of Technology, Cambridge, Massachusetts, USA.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.