Latest update: September 24, 2018


ProGT15.5 (AglI)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.5 (AglI)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglI 
NCBI Gene ID8925953
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglI 
UniProtKB/ SwissProt IDD4GYH2
NCBI Ref SeqWP_013035575.1.
UniProtKB Sequence>sp|D4GYH2|AGLI_HALVD Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglI PE=1 SV=1 MADSPFPCVSVIVPVYNDPTGIRDTLTALTKQTYPTERVNILPIDNGSTDETRDVIRQFE REHENVTLVVEDEIQGSYAARNTGIEQATGEIFAFVDADMYMDESWLETAVDAMDEAAYV GCDIELVTNGEDTLPARFDAQTAFPIAQYIRQQQYAPTCGLLVSREVVDDVGPFDERLVS GGDSEFGSRVANAGYRQAFAPAATLYHPVRDSFSSLVKKELRVGRGLCQRQEYYADRFGR PGIPPRPSGVKSPDEESSGLDFERLLFGVLSVVMTGVRALGYYREYVRYVRGNTR
EMBL CDSCAQ51230.1.
Sequence length295 AA
Subcellular LocationMembrane (Integral component of membrane)
String309800.HVO_1528.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityUDP-Hexuronic acid 
Acceptor Substrate SpecificityDolichol phosphate
Experimental ValidationIn vivo
ProductDolichol phosphate-disaccharide
Donor SpecificityUDP-Hexuronic acid
Function in Glycosylation pathway1) Involved in catalyzing the addition of a hexuronic acid found at position three of the pentasaccharide.
Litrature
Year Of Validation2008 
Reference Yurist?Doutsch, S., Abu?Qarn, M., Battaglia, F., Morris, H. R., Hitchen, P. G., Dell, A., & Eichler, J. (2008). aglF, aglG and aglI, novel members of a gene island involved in the N?glycosylation of the Haloferax volcanii S?layer glycoprotein. Molecular microbiology, 69(5), 1234-1245.

Authors Yurist?Doutsch, S., Abu?Qarn, M., Battaglia, F., Morris, H. R., Hitchen, P. G., Dell, A., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.