Latest update: September 24, 2018


ProGT15.6 (AglJ)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.6 (AglJ)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglJ 
NCBI Gene ID8925594
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglJ 
UniProtKB/ SwissProt IDD4GYG3
NCBI Ref SeqWP_013035422.1.
UniProtKB Sequence>sp|D4GYG3|AGLJ_HALVD Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglJ PE=1 SV=1 MPTPDAVCILTPTYNEAETIADVISDYRDEGFANVLVIDGGSTDGTRELAEDAGAHVVVQ SGSGKGQAVREAVEDHIQAPYVLMLDGDGTYEATDATKMLDPLTEGYDHVIGDRFADMRP GAMTRLNRVGNRIINRAFAFIHGQDFRDILSGYRAFTRESFLDMTLTSDGFGIETEMAVE CAKRGIKTTVVPTTYYPRPDGSDTNLDPIRDGGIIFLELYRRAKTNNPLFYFGSVGFAST ATGLGLALYVAYEWVVRSISHEVIAVVSMAGILFGVQLLMFGVLSDLILSLHREQMKRIE ELE
EMBL CDSCAR66203.1.
Sequence length303 AA
Subcellular LocationMembrane (Integral component of membrane)
String309800.HVO_1517.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) AglJ adds the first sugar of the N-linked pentasaccharide.
Litrature
Year Of Validation2010 
Reference Kaminski, L., Abu-Qarn, M., Guan, Z., Naparstek, S., Ventura, V.V., Raetz, C.R., Hitchen, P.G., Dell, A. & Eichler, J. (2010). AglJ adds the first sugar of the N-linked pentasaccharide decorating the Haloferax volcanii S-layer glycoprotein. Journal of bacteriology, 192(21), 5572-5579.

Authors Kaminski, L., Abu-Qarn, M., Guan, Z., Naparstek, S., Ventura, V.V., Raetz, C.R., Hitchen, P.G., Dell, A. & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.