Latest update: September 24, 2018


ProGT15.7 (AglM)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.7 (AglM)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglM 
NCBI Gene ID8924832
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglM 
UniProtKB/ SwissProt IDD4GYH5
NCBI Ref SeqWP_004041409.1.
UniProtKB Sequence>sp|D4GYH5|AGLM_HALVD UDP-glucose 6-dehydrogenase AglM OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglM PE=1 SV=1 MELSIIGSGYVGTTIAACFAELGHDVVNVDIDEDIVASLNDGQAPIHEPGLAELVERYAG DRLRATTDYDEILDTDATFLALPTPSTDDGSIDLGAMKTAATSLGETLARKDDSHLVVTK STVVPRTTVDVIGPRIEEASGKRVGDGLDIAMNPEFLREGTAVDDFLSPDKIVLGAQTDR AYETLAEIFAPLVERAGNPPVVKTGISEAEMIKYANNAFLASKISLANDLANICKVFGVD SAEVLESIGLDSRIGSAFLGAGLGWGGSCFPKDTAAIIAAARAQGYEPRLLQAAVDVNDG QPERMLDLLRERFDLDGKRVAVLGLAFKPGTDDIRKSRAILLIQALLDAGADVVGYDPVA TENMRERFPDIDYADSAADALANADAALVATDWDEFAALDDEFDAMRERIVIDGRRIVTR REGLDYESLV
EMBL CDSCAY46591.1.
Sequence length430 AA
String309800.HVO_1531.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)1.1.1.22
Sugar Donor SpecificityUDP-glucose 
Experimental ValidationIn vivo
ProductUDP-glucuronate
Donor SpecificityUDP-glucose
Function in Glycosylation pathway1) AglM functions as a NAD(+) dependent UDP-glucose dehydrogenase.
Additional Information1) Involved in the formation of the hexuronic acids found at both positions two and three of the N-linked pentasaccharide. 
Litrature
Year Of Validation2010 
Reference Yurist?Doutsch, S., Magidovich, H., Ventura, V. V., Hitchen, P. G., Dell, A., & Eichler, J. (2010). N?glycosylation in Archaea: on the coordinated actions of Haloferax volcanii AglF and AglM. Molecular microbiology, 75(4), 1047-1058.

Authors Yurist?Doutsch, S., Magidovich, H., Ventura, V. V., Hitchen, P. G., Dell, A., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.