Latest update: September 24, 2018


ProGT15.8 (AglP)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.8 (AglP)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglP 
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglP 
UniProtKB/ SwissProt IDD4GYG5
UniProtKB Sequence>sp|D4GYG5|AGLP_HALVD Hexuronic acid methyltransferase AglP OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglP PE=1 SV=1 MTIVKKVARLRDWIALKTGAIRSPMIAEVSGYAARFTVQSVEEIWRIRDLRGEQDVIRLL LEEAEEDDVLWDVGSNIGTHACICSTKANVFAFEPNPDTFDRLTENSDRAPGTVIPLRYG LSSSSGDISFEPSPIAANGTHKVSTEGSMTIKTISGDELVESGEVPKPNVVKVDVEGHEL EVLKGMTNALQSVNFVIVEIHAGVDPKDVTKLLSEAKLSTEITKLNRDEDFVIGRRQND
EMBL CDSCAW30727.1.
Sequence length239 AA
Subcellular LocationCytoplasm
String309800.HVO_1522.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vitro and In vivo
Function in Glycosylation pathway1) AglP is a S-adenosyl-L-methionine-dependent methyltransferase and responsible for the addition of the methyl group to a hexuronic acid found at position four of the pentasaccharide.
Litrature
Year Of Validation2010 
Reference Magidovich, H., Yurist?Doutsch, S., Konrad, Z., Ventura, V. V., Dell, A., Hitchen, P. G., & Eichler, J. (2010). AglP is a S?adenosyl?L?methionine?dependent methyltransferase that participates in the N?glycosylation pathway of Haloferax volcanii. Molecular microbiology, 76(1), 190-199.

Authors Magidovich, H., Yurist?Doutsch, S., Konrad, Z., Ventura, V. V., Dell, A., Hitchen, P. G., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.