Latest update: September 24, 2018


ProGT15.9 (AglS)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT15.9 (AglS)
Organism Information
Organism NameHaloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 /
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)309800
Genome Information
Gene BankCP001956
EMBLCP001956
Gene Information
Gene NameaglS 
NCBI Reference SequenceNZ_AOHU01000097.1.
Protein information
Protein NameAglS 
UniProtKB/ SwissProt IDD4GYH0
UniProtKB Sequence>sp|D4GYH0|AGLS_HALVD Dolichol phosphate-mannose mannosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglS PE=1 SV=1 MKRLAKAAFSQNSLTAPIVSTFVYLISVVRVVLNGNWPVTSSDTAMFQHIGWMVFSGKRY YIDAWDPKPPLTLELATIIAYISNGDPHLQHTLSVVSTIVAGILLTYLISHITSEITGNQ FAGLLSGIVFITFPVIHYSAVFGYEPKYFVFLFGLGSIYLSRNPKPILSGAAAAASAGMW QFAIIFPIISFGIISRRKSKDLILKYVFGATIIAFISLLPIYLQGGLVAMTVEVIIAPLY AGETQSFLYRLVKGVTHLKLMIPIALLGMAGILLGFLDDIRERWWVVGLLLWFCIQIFIL DYDGADDLFLGIILVSMGIGFAFEKLSTKYESERINSIVTAVVVCMLIWQVVTLGGVGVI TNPYSYSGDGPDQAILESGIQQFAHLSGYTEYTIGGSPPDEQYNVKSRYGPDKIEELFFT STIPSTCHYRLSGMELEWMNLTEQSFTEEKCGKWRLP
EMBL CDSADE02987.1.
Sequence length457 AA
Subcellular LocationMembrane (Integral component of membrane)
String309800.HVO_1526.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)2.4.1.B58
Experimental ValidationIn vitro and In vivo
Function in Glycosylation pathway1) it is dolichol phosphate mannose mannosyltransferase and transfer mannose from dolichol phosphate to the N-linked tetrasaccharide.
Litrature
Year Of Validation2012 
Reference Cohen-Rosenzweig, C., Yurist-Doutsch, S., & Eichler, J. (2012). AglS, a novel component of the Haloferax volcanii N-glycosylation pathway, is a dolichol phosphate-mannose mannosyltransferase. Journal of bacteriology, JB-01716.

Authors Cohen-Rosenzweig, C., Yurist-Doutsch, S., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.