Latest update: September 24, 2018


ProGT16.1 (AglA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT16.1 (AglA)
Organism Information
Organism NameMethanococcus voltae PS
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)2188
Genome Information
Gene BankDQ372941
EMBLDQ372941
Gene Information
Gene NameaglA 
NCBI Reference SequenceDQ372941
Protein information
Protein NameAglA 
UniProtKB/ SwissProt IDQ2EMU7
UniProtKB Sequence>tr|Q2EMU7|Q2EMU7_METVO Glycosyltransferase OS=Methanococcus voltae GN=MVO0151 PE=4 SV=1 MKILMTATNPVTNDPRILKEAKALIEAGHDITIVAWDRECKNPSETTKEGINIIRVPVRA SYGNMKEFIKTLPIFYKKAYKIIKKLDFDAIHTHDFDTAFLGYILKKQGIKSKDTNKRIK WVYDVHDLYESFVEKNNPNLSKIISKLDGIFMKNADTLIVTTEYVRDLLSKRMPEVSKKI TIVSNSINSPNILLKTDKSEFMVFYGGVLSRTRYILEMMDICEELNIKMTIAGIGVLENE IKKRCEKSNYLKFLGELPHKELLEEMNDYSLNFAIYDPSIQNNMISVPNKLFESMCLGIP IIVIEGSYMANVVTTNNCGLTVQFNEQSVQEHFKIKN
EMBL CDSABD17737.1.
Sequence length337 AA
Glycosylation Information
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) AglA involved in the attachment of the terminal sugar to the glycan.
Litrature
Year Of Validation2006 
Reference Chaban, B., Voisin, S., Kelly, J., Logan, S. M., & Jarrell, K. F. (2006). Identification of genes involved in the biosynthesis and attachment of Methanococcus voltae N?linked glycans: insight into N?linked glycosylation pathways in Archaea. Molecular microbiology, 61(1), 259-268.

Authors Chaban, B., Voisin, S., Kelly, J., Logan, S. M., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, K7L 3N6, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, K7L 3N6, Canada.
Reference Chaban, B., Voisin, S., Kelly, J., Logan, S. M., & Jarrell, K. F. (2006). Identification of genes involved in the biosynthesis and attachment of Methanococcus voltae N?linked glycans: insight into N?linked glycosylation pathways in Archaea. Molecular microbiology, 61(1), 259-268.

Authors Chaban, B., Voisin, S., Kelly, J., Logan, S. M., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, K7L 3N6, Canada.
Corresponding Author Imperiali, B.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, K7L 3N6, Canada.