Latest update: September 24, 2018


ProGT16.3 (AglC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT16.3 (AglC)
Organism Information
Organism NameMethanococcus voltae PS
Domain Archaebacteria
Phylum Euryarchaeota
ClassificationFamily: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)2188
Genome Information
Gene BankDQ372941
EMBLDQ372941
Gene Information
Gene NameaglC 
NCBI Reference SequenceDQ372941
Protein information
Protein NameAglC 
UniProtKB/ SwissProt IDB3VA59
UniProtKB Sequence>sp|B3VA59|AGLC_METVO Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase OS=Methanococcus voltae GN=aglC PE=1 SV=1 MNFISIIIPTFNEEKYITKCLENWFNQDYPKENYEILIFDGKSTDKTLDVIKELQKKHNF ENIKIYTNEKRKQVYAFNEGIKNANGDFFIIFGAHAYPEQDFLKNNIETYQRIKKEEPKL AGVGGIINKISENMSAEIAKVIYSTPLSGGSSFWYAKEGFFSNTVVYGMYDTKMIKESEI LFDTDFITGQDFEFNLHLIKEGFKLYTNPNIVSSYYTRSSVKKFIKQTISYGAAKGLMIR KGYFNILWLFPFGFLFMLLSIIITGLLIFIYIMAILIDTIRLLIKTREPLYIALPILLFL FHCLISYGFFKGLIKGNSTFK
EMBL CDSACE74695.1.
Sequence length321 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.335
Sugar Donor Specificity UDP-Glc-2,3-diNAcA 
Acceptor Substrate SpecificityDol-P-GlcNAc
Experimental ValidationIn vivo
ProductDol-P-GlcNAc-Glc-2,3-diNAcA
Donor Specificity UDP-Glc-2,3-diNAcA
Function in Glycosylation pathway1) AglC is Glc-2,3-diNAcA glycosyltransferase, It transfers Glc-2,3-diNAcA to Dol-P-GlcNAc to form a beta-1,3 linkage.
Litrature
Year Of Validation2009 
Reference Chaban, B., Logan, S. M., Kelly, J. F., & Jarrell, K. F. (2009). AglC and AglK are involved in biosynthesis and attachment of diacetylated glucuronic acid to the N-glycan in Methanococcus voltae. Journal of bacteriology, 191(1), 187-195.

Authors Chaban, B., Logan, S. M., Kelly, J. F., & Jarrell, K. F.
Research groupsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, K7L 3N6, Canada.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Microbiology and Immunology, Queens University, Kingston, Ontario, K7L 3N6, Canada.
Reference Larkin, A., Chang, M. M., Whitworth, G. E., & Imperiali, B. (2013). Biochemical evidence for an alternate pathway in N-linked glycoprotein biosynthesis. Nature chemical biology, 9(6), 367.

Authors Larkin, A., Chang, M. M., Whitworth, G. E., & Imperiali, B.
Research groupsDepartment of Chemistry, Massachusetts Institute of Technology, Cambridge, Massachusetts, USA.
Corresponding Author Jarrell, K. F.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.