Latest update: September 24, 2018


ProGT17.1 (PglB)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT17.1 (PglB)
Organism Information
Organism NameNeisseria meningitidis C311#3
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)487
Genome Information
Gene BankCP020421
EMBLCP020421
Gene Information
Gene NamepglB 
NCBI Reference SequenceNZ_FFDT01000011.1
Protein information
Protein NamePglB 
UniProtKB/ SwissProt IDQ9RR58
NCBI Ref SeqWP_002225656.1
UniProtKB Sequence>tr|Q9RR58|Q9RR58_NEIME PglB OS=Neisseria meningitidis GN=pglB PE=4 SV=1 MSKFFKRLFDIVASASGLIFLSPVFLILIYLIRKNLGSPVFFFQERPGKDGKPFKMVKFR SMRDALDSDGIPLPDGERLTPFGKKLRAASLDELPELWNILKGEMSLVGPRPLLMQYLPL YDNFQNRRHEMKPGITGWAQVNGRNALSWDEKFACDVWYIDHFSLCLDIKILLLTVKKVL IKEGISAQGEATMPPFTGKRKLAVVGAGGHGKVVADLAAALGRYREIVFLDDRAQGSVNG FSVIGTTLLLENSLSPEQYDVAVAVGNNRIRRQIAEKAAALGFALPVLVHPDATVSPSAT VGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLNAFVHISPGAHLSGNTHIGEESW IGTGACSRQQIRIGSRATIGAGAVVVRDVSDGMTVAGNPAKPLPRKNPETSTA
EMBL CDSAAC25979.1.
Sequence length413 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) PglB probably involved in the early steps of trisaccharide biosynthesis, namely in the biosynthesis of the ?rst sugar residue and its transfer either to an undecaprenol phosphate lipid carrier or to serine 63 of the pilin.
Litrature
Year Of Validation2000 
Reference Power, P. M., Roddam, L. F., Dieckelmann, M., Srikhanta, Y. N., Tan, Y. C., Berrington, A. W., & Jennings, M. P. (2000). Genetic characterization of pilin glycosylation in Neisseria meningitidis. Microbiology, 146(4), 967-979.

Authors Power, P. M., Roddam, L. F., Dieckelmann, M., Srikhanta, Y. N., Tan, Y. C., Berrington, A. W., & Jennings, M. P.
Research groupsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Corresponding Author Jennings, M. P.
ContactsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.