Latest update: September 24, 2018


ProGT17.2 (PglC)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT17.2 (PglC)
Organism Information
Organism NameNeisseria meningitidis C311#3
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)487
Genome Information
Gene BankCP020421
EMBLCP020421
Gene Information
Gene NamepglC 
NCBI Reference SequenceNZ_FFDT01000011.1
Protein information
Protein NamePglC 
UniProtKB/ SwissProt IDQ9RR57
NCBI Ref SeqWP_002222986.1.
UniProtKB Sequence>tr|Q9RR57|Q9RR57_NEIME PglC OS=Neisseria meningitidis GN=pglC PE=3 SV=1 MLNTFLSPWPCFTQEEADAVSKVLLSNKVNYWTGNECREFEKEFAAFAGTRYAVALANGT LALDVALKAMGIGAGDDVIVTSRTFLASASCIVNAGANPVFADVDLNSQNISAETVKAAL TPTTKAVIVVHLAGMPAEMDGIMALAKEHNLWVIEDCAQAHGAKYKGKSVGSIGHVGAWS FCQDKIMTTGGEGGMVTTNDKTLWEKMWSYKDHGKSYDAVYNHEHAPGFRWLHESFGTNW RMMEMQAVIGRIQLKRLPEWTARRRENAAKLAESLGKFSSIRLVEVADYIGHAQYKFYAF VKPEHLKDGWTRDRIVGELNARKVPCYQGSCSEVYLEKAFDNTPWRPKERLTNAVELGDT SLMFLVHPTLTDDEIAFCKKHIEAVLTEAAR
EMBL CDSAAC25980.1.
Sequence length391 AA
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)2.6.1-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) PglC is aminotransferase required for the transamination of either C2 or C4 in the synthesis of acetamido sugar of N. meningitidis
Litrature
Year Of Validation2000 
Reference Power, P. M., Roddam, L. F., Dieckelmann, M., Srikhanta, Y. N., Tan, Y. C., Berrington, A. W., & Jennings, M. P. (2000). Genetic characterization of pilin glycosylation in Neisseria meningitidis. Microbiology, 146(4), 967-979.

Authors Power, P. M., Roddam, L. F., Dieckelmann, M., Srikhanta, Y. N., Tan, Y. C., Berrington, A. W., & Jennings, M. P.
Research groupsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Corresponding Author Jennings, M. P.
ContactsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.