Latest update: September 24, 2018


ProGT17.3 (PglD)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT17.3 (PglD)
Organism Information
Organism NameNeisseria meningitidis C311#3
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)487
Genome Information
Gene BankCP020421
EMBLCP020421
Gene Information
Gene NamepglD 
NCBI Reference SequenceNZ_FFDP01000007.1
Protein information
Protein NamePglD 
UniProtKB/ SwissProt IDX5F765
NCBI Ref SeqWP_002246409.1.
UniProtKB Sequence>tr|X5F765|X5F765_NEIME Pilin glycosylation protein OS=Neisseria meningitidis GN=pglD PE=4 SV=1 MTLETLIALPRNIKKICFLIHDFLMIFIAFWFTQSLKADYSNEWFDPANWQSFLLTALLT IGLFVRMGLYRAVTRFISFRILSTALAGSLASAVLFFLNTLIFEERLRLALPIVYFLLLF VSVTGSRMVLRGLLSEHPKKQMTPVIIYGAGQAGRQLLEAVKQMREYSAAAFVDDDPKLW HTVIYDLAVYQPDAIAFLIERYGVEKILLAIPGATQEQRRRIINKLEAYPCEVLTIPGMK DLMDGKISIGTLKKISVSDLLGRDSVTPDDRLMSADIEGKTVMVTGAGGSIGSELCRQII RRRPEKLLLFELSEFALYAIEKELRETCIQKRLDTEILPFLGSVQNRTLLEHVMTAFSVA TVYHAAAYKHVPMVEFNTVEGIRNNIFGTLECALAATTSGVRTFVLISTDKAVRPTNTMG ASKRMAELCLQALAAEPGQKTRFSMVRFGNVLGSSGSVVPLFEKQIAEGGPLTLTHPDIT RYFMTIPEAAQLVIQAGAMGTGGDVFVLDMGESVKIIDLARQMITLSGLKPKTPEQPDGD IEILITGLRPGEKLYEELLIGDNVRKTGHPRIMTADEAMLPWHELSVLLDRIRAACDRYD QQAIRTLLINAPTGFTPSDGICDLLWVRETHRKNAV
EMBL CDSAHW75013.1.
Sequence length636 AA
Subcellular LocationMembrane (Integral component of membrane)
String122586.NMB1822.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)1.1.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) PglD is a dehydratase, required for the synthesis of the DADTH glycan of the pilin-linked trisaccharide.
Litrature
Year Of Validation2000 
Reference Power, P. M., Roddam, L. F., Dieckelmann, M., Srikhanta, Y. N., Tan, Y. C., Berrington, A. W., & Jennings, M. P. (2000). Genetic characterization of pilin glycosylation in Neisseria meningitidis. Microbiology, 146(4), 967-979.

Authors Power, P. M., Roddam, L. F., Dieckelmann, M., Srikhanta, Y. N., Tan, Y. C., Berrington, A. W., & Jennings, M. P.
Research groupsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Corresponding Author Jennings, M. P.
ContactsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.