Latest update: September 24, 2018


ProGT17.4 (PglE)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT17.4 (PglE)
Organism Information
Organism NameNeisseria meningitidis C311#3
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)487
Genome Information
Gene BankCP020421
EMBLCP020421
Gene Information
Gene NamepglE 
Protein information
Protein NamePglE 
UniProtKB/ SwissProt IDQ9AER5
UniProtKB Sequence>tr|Q9AER5|Q9AER5_NEIME Glycosyltransferase PglE OS=Neisseria meningitidis GN=pglE PE=4 SV=1 MDLSIVVPIYNVESYLEACLSSIESILSNENVELILVNDGSKDGSEDICYKYIDKISNSK QQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKHRTP NIKYIYQDNQGLSEARNTGIKNSNGKYIVFIDSDDFINCQILLDFLSKDDTDMPDVVFLN AVKYDKGSVSYFGEDYQPEKILNQSKVEVLKGLCRFRKFPGSAWNKIIKRELIIREKLFF ERGIYSEDIEWSMRLFNAATTFSYLDGCYYYYRQGRKDSITGTVSEKSIKSLLYILEKNA EMEFNRDISSYLYSLFSYEYLVLLFIMTSKNIECDADIKRRAYHLRFMLLKSNKLIYKLI FPIITLLGVDITGRILKAIRGNI
EMBL CDSAAK29178.1.
Sequence length383 AA
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Function in Glycosylation pathway1) PglE is a galactosyltransferase and required for the biosynthesis of the trisaccharide structure.
Litrature
Year Of Validation2003 
Reference Power, P. M., Roddam, L. F., Rutter, K., Fitzpatrick, S. Z., Srikhanta, Y. N., & Jennings, M. P. (2003). Genetic characterization of pilin glycosylation and phase variation in Neisseria meningitidis. Molecular microbiology, 49(3), 833-847.

Authors Power, P. M., Roddam, L. F., Rutter, K., Fitzpatrick, S. Z., Srikhanta, Y. N., & Jennings, M. P.
Research groupsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Corresponding Author Jennings, M. P.
ContactsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.