Latest update: September 24, 2018


ProGT17.6 (PglI)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT17.6 (PglI)
Organism Information
Organism NameNeisseria meningitidis C311#3
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)487
Genome Information
Gene BankCP020421
EMBLCP020421
Gene Information
Gene NamepglI 
NCBI Reference SequenceNZ_FETZ01000035.1
Protein information
Protein NamePglI 
UniProtKB/ SwissProt IDQ9JXY4
NCBI Ref SeqWP_002261325.1.
UniProtKB Sequence>tr|Q9JXY4|Q9JXY4_NEIME Acetyltransferase PglI OS=Neisseria meningitidis GN=pglI PE=4 SV=1 MSQALPYRPDIDTLRAAAVLSVIVFHIEKDWLPGGFLGVDIFFVISGFLMTTILHREMSG GGGRFSLKAFYIRRIKRILPAFFAVLAATLAGGFFLFTKDDFFLLWKSALTALGFASNLY FARGKDYFDPAQEEKPLLHIWSLSVEEQFYFVFPILLLLVARKSLRVQFGFLAALCALSL AASFIPSALDKYYLPHLRACELLIGSLTAVWMRCRQPAVGRRCAAVGALFAVCILSTCLF SYSEQTAYFPGPAALIPCLAVAALIYFNHYEHPLKKFFQSKITVAAGLISYSLYLWHWPI LAFMRYIGPDNLPPYSPAAAVVLILLLSLFSYHCIEKPFKKWQGSFAQSVLWIYALPMLI LGAGSFFAMRLPFMAQYDRLGLTRSNTSCHNNTGKQCLWGDTEKQPELLVLGDSHADHYK TFFDAVGKKEKWSATMVSADACAYVEGYASRVFQNWAACRAVYRYAEEHLPRYSKVVLAM RWGSQMPENSRSLAYDAGFFQKFDRMLHKLSSEKQAVYLMADNLASSYNVQRAYILSSRI PGYRQALRPDDESTLKANARIRELAAKYPNVYIIDAAAYIPADFQIGGLPVYSDKDHINP YGGTELAKRFSEKQRFLDTRHNH
EMBL CDSAAM66708.1.
Sequence length623 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) PglI is involved in the biosynthesis of the DATDH sugar.
Litrature
Year Of Validation2004 
Reference Warren, M. J., Roddam, L. F., Power, P. M., Terry, T. D., & Jennings, M. P. (2004). Analysis of the role of pglI in pilin glycosylation of Neisseria meningitidis. FEMS Immunology & Medical Microbiology, 41(1), 43-50.

Authors Warren, M. J., Roddam, L. F., Power, P. M., Terry, T. D., & Jennings, M. P.
Research groupsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Corresponding Author Jennings, M. P.
ContactsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Reference Warren, M. J., Roddam, L. F., Power, P. M., Terry, T. D., & Jennings, M. P. (2004). Analysis of the role of pglI in pilin glycosylation of Neisseria meningitidis. FEMS Immunology & Medical Microbiology, 41(1), 43-50.

Authors Warren, M. J., Roddam, L. F., Power, P. M., Terry, T. D., & Jennings, M. P.
Research groupsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.
Corresponding Author Logan, S.
ContactsDepartment of Microbiology and Parasitology, The University of Queensland, Brisbane, Australia.