Latest update: September 24, 2018


ProGT18.2 (PseF)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT18.2 (PseF)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)354242
Genome Information
Gene BankCP000538
EMBLCP000538
Gene Information
Gene NamepseF 
NCBI Reference SequenceNC_008787.1
Protein information
Protein NamePseF 
UniProtKB/ SwissProt IDQ2M5Q2
NCBI Ref SeqWP_002869384.1
UniProtKB Sequence>sp|Q2M5Q2|PSEF_CAMJJ Pseudaminic acid cytidylyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pseF PE=3 SV=1 MKNLCIIPARGGSKRIPRKNIIDFLGKPLIAYSIENALNSGIFDEIVLSSDDEEIIEVAL KYGAKAPFVRDKNLSDDYASSTAAVQNAIEILQSQNQIYDHVCCLYATAPLLNKNILKQA YEKFIQNQSKFLFAATEFEYPIQRAFYLNENNQVYMFDEKHYKSRSQDLTKAYHDAGAFY FGTSKAWLEEDFIFKPHSSVFVLPRNLVCDIDTMQDLEFAKILYKVNHESAF
EMBL CDSABC69287
Sequence length232 AA
String354242.Cjejjejuni_010100006975.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)2.7.7.81
Experimental ValidationIn vivo
Additional Information1) Mutational analysis of pseF gene revealed that it is involved in flagellin glycosylation. 
Litrature
Year Of Validation2006 
Reference McNally, D.J., Hui, J.P., Aubry, A.J., Mui, K.K., Guerry, P., Brisson, J.R., Logan, S.M. & Soo, E. C. (2006). Functional characterization of the flagellar glycosylation locus in Campylobacter jejuni 81-176 using a focused metabolomics approach. Journal of Biological Chemistry.

Authors McNally, D.J., Hui, J.P., Aubry, A.J., Mui, K.K., Guerry, P., Brisson, J.R., Logan, S.M. & Soo, E. C.
Research groupsNational Research Council, Institute for Biological Sciences, Ottawa, Ontario K1A 0R6, Canada.
Corresponding Author Soo, E. C.
ContactsNational Research Council, Institute for Biological Sciences, Ottawa, Ontario K1A 0R6, Canada.
Reference Guerry, P., Ewing, C.P., Schirm, M., Lorenzo, M., Kelly, J., Pattarini, D., Majam, G., Thibault, P. & Logan, S. (2006). Changes in flagellin glycosylation affect Campylobacter autoagglutination and virulence. Molecular microbiology, 60(2), 299-311.

Authors Guerry, P., Ewing, C.P., Schirm, M., Lorenzo, M., Kelly, J., Pattarini, D., Majam, G., Thibault, P. & Logan, S.
Research groupsEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave, Silver Spring, MD, USA.
Corresponding Author Logan, S.
ContactsEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave, Silver Spring, MD, USA.