Latest update: September 24, 2018


ProGT18.8 (PseH)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT18.8 (PseH)
Organism Information
Organism NameCampylobacter jejuni subsp. jejuni PT14
Domain Bacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)1201032
Genome Information
Gene BankCP003871
EMBLCP003871
Gene Information
Gene NamepseH 
NCBI Reference SequenceNC_018709.4
Protein information
Protein NamePseH 
UniProtKB/ SwissProt IDA0A0J9X276
NCBI Ref SeqWP_002781802.1
UniProtKB Sequence>tr|A0A0J9X276|A0A0J9X276_CAMJU N-Acetyltransferase, PseH OS=Campylobacter jejuni subsp. jejuni PT14 GN=A911_06385 PE=1 SV=1 GSAKDPLIKLKNFTELNSQEIELIFKWRNHPDINQFMKTKYIDFEEHLRFLKKLHQDSSK KYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLK AYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQSNCKALPS
Sequence length163 AA
PDB ID (Structural Information)4XPK, 4XPL
Glycosylation Information
CAZY FamilyNon-GT
Acceptor Substrate SpecificityUDP-4-amino-4,6-dideoxy-N-acetyl-b-L-altrosamine
ProductUDP-2,4-diacetamido-2,4,6-trideoxy-b-L-altropyranose.
Function in Glycosylation pathway1) PseH is N-acetyltransferases, it acetylates the 4-amino group of UDP-4-amino-4,6-dideoxy-N-acetyl-b-L-altrosamine using an acetyl donor, acetyl coenzyme A (AcCoA), to generate UDP-2,4-diacetamido-2,4,6-trideoxy-b-L-altropyranose.
Litrature
Year Of Validation2015 
Reference Song, W. S., Nam, M. S., Namgung, B., & Yoon, S. I. (2015). Structural analysis of PseH, the Campylobacter jejuni N-acetyltransferase involved in bacterial O-linked glycosylation. Biochemical and biophysical research communications, 458(4), 843-848.

Authors Song, W. S., Nam, M. S., Namgung, B., & Yoon, S. I.
Research groupsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada.
Corresponding Author Yoon, S. I.
ContactsInstitute for Biological Sciences, National Research Council, Ottawa, Ontario, Canada.