Latest update: September 24, 2018


ProGT25.1 (PglA)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT25.1 (PglA)
Organism Information
Organism NameNeisseria meningitidis serogroup B (strain MC58)
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)122586
Genome Information
Gene BankAE002098
EMBLAE002098
Gene Information
Gene NamepglA 
NCBI Gene ID902330
NCBI Reference SequenceNC_003112.2.
Protein information
Protein NamePglA 
UniProtKB/ SwissProt IDQ9K1D9
NCBI Ref SeqWP_002221887.1.
UniProtKB Sequence>tr|Q9K1D9|Q9K1D9_NEIMB Glycosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pglA PE=4 SV=1 MKIVFITTVASSIYGFRAPVIKKLIGKNHQVYAFVSEFSDNELDIIREMGVTPVTYRSNR SGLNPFSDIKSTFLIFKELKKISPDLVFPYFAKPVIFGTFAAKLAGVPRIVGMLEGLGFA FTPQPEGIPLKTKIIKGILIALYRIALPMLESLIVLNPDDKDELTDKYGIKIKNIHILGG IGLDLRQYPYSEADIPDEKEPVKFLFIGRFLKEKGIDDFIRAAEQVKDKYPDTVFTALGA IDKSRGGGGDLERLAARDIIRFPGFVNNVSEVIKEHHIFVLPSYYREGVPRSTQEAMAVG RAVITTDVPGCRETVADKVNGFLIEPWNPRILAEKMIYFIENREAVRLMGNASYAIAKDK FDAEKVDLKLLDILKA
EMBL CDSAAF40674.1.
Sequence length376 AA
String122586.NMB0218.
Glycosylation Information
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityUDP-Galactose 
Acceptor Substrate SpecificityUnd-PP-diNAcBac
Experimental ValidationIn vivo
ProductUnd-PP-diNAcBac-Gal
Donor SpecificityUDP-Galactose
Function in Glycosylation pathway1) PglA is a glycosyltransferase responsible for the addition of galactose of the trisaccharide glycan in pilin modification.
Litrature
Year Of Validation1998 
Reference Jennings, M.P., Virji, M., Evans, D., Foster, V., Srikhanta, Y.N., Steeghs, L., Van Der Ley, P. & Moxon, E. R. (1998). Identification of a novel gene involved in pilin glycosylation in Neisseria meningitidis. Molecular microbiology, 29(4), 975-984.

Authors Jennings, M.P., Virji, M., Evans, D., Foster, V., Srikhanta, Y.N., Steeghs, L., Van Der Ley, P. & Moxon, E. R.
Research groupsDepartment of Microbiology, The University of Queensland, Brisbane, Australia.
Corresponding Author Moxon, E. R.
ContactsDepartment of Microbiology, The University of Queensland, Brisbane, Australia.