Latest update: September 24, 2018


ProGT25.4 (PglD)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT25.4 (PglD)
Organism Information
Organism NameNeisseria meningitidis serogroup B (strain MC58)
Domain Bacteria
Phylum Proteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)122586
Genome Information
Gene BankAE002098
EMBLAE002098
Gene Information
Gene NamepglD 
NCBI Gene ID903278
NCBI Reference SequenceNC_003112.2.
Protein information
Protein NamePglD 
UniProtKB/ SwissProt IDQ7DD74
NCBI Ref SeqWP_002222987.1.
UniProtKB Sequence>tr|Q7DD74|Q7DD74_NEIMB Pilin glycosylation protein PglD OS=Neisseria meningitidis serogroup B (strain MC58) GN=pglD PE=4 SV=1 MNLETLIALPRNIKKICFLIHDFLMIFIAFWFTQSLKADYSDEWFDFANWQSFLLTALLT ITLFIRMGLYHAVTRFVSFRILTTALAGSLASAVLFFLNTLIFEERLRLALPIVYFLLLF VSVTGSRMVLRGLLSEHPKKQMIPVIIYGAGRSGRQLLEAVKQMREYSAAAFVDDDPKLW HTVIYDLAVYQPDAIAFLIERYGVEKILLAIPGATQEQRRRIINKLEAYPCEVLTIPGMK DLMDGKISIGTLKKISVSDLLGRDSVAPDDRLMSADIEGKTVMVTGAGGSIGSELCRQII RRRPEKLLLFELSEFALYAIEKELRETCIQKRLDTEILPFLGSVQNRTLLEHVMTAFSVA TVYHAAAYKHVPMVEFNTVEGIRNNIFGTLECALAATTSGVRTFVLISTDKAVRPTNTMG ASKRMAELCLQALAAEPGQKTRFSMVRFGNVLGSSGSVVPLFEKQIAEGGPLTLTHPEIT RYFMTIPEAAQLVIQAGAMGTGGDVFVLDMGESVKIIDLARQMITLSGLKPNTPEQPDGD IEILITGLRPGEKLYEELLIGDNVRKTGHPRIMTANETMLPWHELSALLDRIRAACDRYD QQAIRTLLINAPTGFAPSDGICDLLWVRETHRKNAV
EMBL CDSAAF42157.1.
Sequence length636 AA
Subcellular LocationMembrane (Integral component of membrane)
String122586.NMB1822.
Glycosylation Information
CAZY FamilyNon-GT
Experimental ValidationIn vivo
Function in Glycosylation pathway1) It has a dehydratase activity.
Additional Information1) Mutation in pglD gene shows that it plays an important role in pilin glycosylation. 
Litrature
Year Of Validation2001 
Reference Kahler, C. M., Martin, L. E., Tzeng, Y. L., Miller, Y. K., Sharkey, K., Stephens, D. S., & Davies, J. K. (2001). Polymorphisms in pilin glycosylation locus of Neisseria meningitidis expressing class II pili. Infection and immunity, 69(6), 3597-3604.

Authors Kahler, C. M., Martin, L. E., Tzeng, Y. L., Miller, Y. K., Sharkey, K., Stephens, D. S., & Davies, J. K.
Research groupsDepartment of Microbiology, Monash University, Clayton, Australia.
Corresponding Author Davies, J. K.
ContactsDepartment of Microbiology, Monash University, Clayton, Australia.