Latest update: September 24, 2018


ProGT33.5 (GtfG)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT33.5 (GtfG)
Organism Information
Organism NameStreptococcus agalactiae serotype III (strain NEM316)
Domain Bacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)211110
Genome Information
Gene BankAL766851
EMBLAL766851
Gene Information
Gene Namegbs1527 
NCBI Reference SequenceCAD47186
Protein information
Protein NameGtfG 
UniProtKB/ SwissProt IDQ8E475
NCBI Ref SeqWP_000751408.1
UniProtKB Sequence>tr|Q8E475|Q8E475_STRA3 Uncharacterized protein OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1527 PE=4 SV=1 MKKTIVLGADFQYRDQVMTTIKSIVSHNQHLTIYIINTDFPVEWFNILNHSLEQFDCRVK NIPISSDVFEGIPTLSHISVAGFFRWFIPIHLEEEIVLYLDSDVIVRGSLDPLFDINLEE NLLGAVADHFSTLYYGDTAPVSFNSGVMLINNSLWKKEEIYNSLMRIADKGSAVGVGDQE YLNILTQNRWIDIGKQYNVQIGQDVNINAYGRPDLYHFYDDCEPVIVHYNSQDKPWNKYS QSRYRSEWWYYFGLEWSVIYAQQQKNLNRLTGKTLNLFTLTASDTLEHIEVLAKALPDYQ FHIAARSDISEKLANLETYSNIKVYKLVINPILEELIRNCDVYLDINHSYEVEGILDKIK EENKPILAFDSTAHTTKNIEVISETMPELMVKRIREVGPLR
EMBL CDSCAD47186.1
Sequence length401 AA
String211110.gbs1527.
Glycosylation Information
CAZY FamilyGT8
EC Number (BRENDA)2.4.1.-
Experimental ValidationIn vivo
Additional Information1) Srr1 is important for the virulence of S. agalactiae NEM316.
2) The reactivity of Srr1 toward lectin and the monosaccharide composition analysis of full-length protein showed that Srr1 was mainly modified with GlcNAc and Glc residues, strongly suggesting that HexNAc and Hex should correspond to these two sugars.  
Litrature
Year Of Validation2009 
Reference Mistou, M. Y., Dramsi, S., Brega, S., Poyart, C., & Trieu-Cuot, P. (2009). Molecular dissection of the secA2 locus of group B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence. Journal of bacteriology, 191(13), 4195-4206.

Authors Mistou, M. Y., Dramsi, S., Brega, S., Poyart, C., & Trieu-Cuot, P.
Research groupsInstitut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
Corresponding Author Trieu-Cuot, P.
ContactsInstitut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France.
Reference Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. & Mistou, M. Y. (2014). O-glycosylation of the N-terminal region of the serine-rich adhesin Srr1 of Streptococcus agalactiae explored by mass spectrometry. Molecular & Cellular Proteomics, mcp-M114.

Authors Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. & Mistou, M. Y.
Research groups1 INRA MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France; AgroParisTech, MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France. Shepherd Institute, Mass Spectrometry and Proteomics Structural Unit, 28 rue du Dr. Roux, 75015 Paris, France 2 INRA, PAPPSO, MICALIS UMR-1319, 78352 Jouy en Josas cedex, France 3INRA, PAPPSO, Plant Genetics UMR-320, Ferme du Moulon, 91190 Gif sur Yvette, France; 4 Shepherd Institute, Mass Spectrometry and Proteomics Structural Unit, 28 rue du Dr. Roux, 75015 Paris, France; CNRS UMR 3528, Pasteur Institute, 28 rue du Dr. Roux, 75015 Paris, Francee 5 CEA, Institute of Structural Biology Jean-Pierre Ebel, F-38027 Grenoble, France 6 Institut Pasteur Bacteria Biology of Pathogenic Gram +, 28, rue du Dr Roux, 75015 Paris, France; Centre National Center for Scientific Research, CNRS ERL3526, Paris, France 7 INRA MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France
Corresponding Author Mistou, M. Y.
ContactsINRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France