Latest update: September 24, 2018


ProGT35.1 (Ppm1)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT35.1 (Ppm1)
ProGT Pathway
Organism Information
Organism NameStreptomyces coelicolor J1929
Domain Bacteria
PhylumTerrabacteria
ClassificationFamily: Streptomycetaceae
Suborder: Streptomycineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)100226
Genome Information
Gene BankAL939108
EMBLAL939108
Gene Information
Gene Nameppm1 
NCBI Gene ID1096849
NCBI Reference SequenceNC_003888.3.
Protein information
Protein NamePpm1 
UniProtKB/ SwissProt IDQ9RKY2
NCBI Ref SeqWP_011027779.1.
UniProtKB Sequence>tr|Q9RKY2|Q9RKY2_STRCO Putative glycosyl transferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1423 PE=4 SV=1 MNDGDGTPAAAARERRFGPLGTALVIIPTYNEAENIKAIVTRVREAVPEAHVLVADDNSP DGTGKLADELAAADDHVQVMHRKGKEGLGAAYLAGFRWGLEHGYGVLIEMDADGSHQPEE LPRLLTALKGADLVLGSRWVPGGRVVNWPKSREIISRGGSMYSRIALDLPLRDITGGYRA FRRETLEGLGLEEVASQGYCFQVDLARRAIKAGYHVVEVPITFVERELGDSKMSRDILVE ALWRVTTWGVGERVGKVLGRDRRSGTAADGQTASSGTDGRTASSDRSTDSLDESAKASDA KA
EMBL CDSCAB61668.1.
Sequence length302 AA
String100226.SCO1423.
Glycosylation Information
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Sugar Donor SpecificityGDP-Mannose 
Acceptor Substrate SpecificityPolyprenol phosphate
ProductPolyprenol phosphate-Man
Donor SpecificityGDP-Mannose
Function in Glycosylation pathway1) Transfer mannose to endogenous polyprenol phosphate in the membrane.
Litrature
Year Of Validation2009 
Reference Wehmeier, S., Varghese, A. S., Gurcha, S. S., Tissot, B., Panico, M., Hitchen, P., ... & Smith, M. C. M. (2009). Glycosylation of the phosphate binding protein, PstS, in Streptomyces coelicolor by a pathway that resembles protein O?mannosylation in eukaryotes. Molecular microbiology, 71(2), 421-433.

Authors Wehmeier, S., Varghese, A. S., Gurcha, S. S., Tissot, B., Panico, M., Hitchen, P., ... & Smith, M. C. M.
Research groupsSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
Corresponding Author Smith, M. C. M.
ContactsSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
Reference Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L. (2014). Lipoprotein N-acyl transferase (Lnt1) is dispensable for protein O-mannosylation by Streptomyces coelicolor. FEMS microbiology letters, 350(1), 72-82.

Authors Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L.
Research groupsDepartment of Molecular Biology and Biotechnology, Institute of Biomedical Research, National Autonomous University of Mexico, Ciudad University, Mexico City, Mexico City.
Corresponding Author Smith, M. C. M.
ContactsDepartment of Molecular Biology and Biotechnology, Institute of Biomedical Research, National Autonomous University of Mexico, Ciudad University, Mexico City, Mexico City.