Latest update: September 24, 2018


ProGT51.1 (Agl3)

Home -> ProGTdb -> Search ProGT_Accessory -> Display data

ProGT ID ProGT51.1 (Agl3)
Organism Information
Organism NameSulfolobus acidocaldarius
Domain Archaebacteria
PhylumCrenarchaeota
ClassificationFamily: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)330779
Genome Information
Gene BankCP000077
EMBLCP000077
Gene Information
Gene Nameagl3 
NCBI Gene ID3473183
NCBI Reference SequenceNC_007181.1.
Protein information
Protein NameAgl3 
UniProtKB/ SwissProt IDQ4JBJ3
NCBI Ref SeqWP_011277338.1.
UniProtKB Sequence>tr|Q4JBJ3|Q4JBJ3_SULAC Epimerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0423 PE=4 SV=1 MRILVLGIDGHLGWPLALRLAKRGHEVIGIDNLSTRRFSEEVGSDSAFPLPQPQERVSEA KKHLGVDITFYVGDITNYGFFKDIVQRYKPDAIVHFAEQRSAPYSMIDMDHAVYTVINNE VSTLRVIQAVLEVDPTIHILKMGTMGEYGTPAFDIPESIYVEAIVNGKKDKIIVPRKAGS VYHWTKVHDTDFLLHFQELYGLTVTDIMQGPVYGTRTEEIVEETLRTRFDFDEVWGTVVN RYCVEAILGLPLTVYGKGGQTRGFISLEDSIQALTLLLENPPKQGEYRVANQFAEIYSVK KIAEFVKKAGEELGLNVEIGSYENPRVEAEEHYYNPERKVLPSLGFYPKKRLPEDVKIMI KDLLPYKTRLERFKHVILPKTKWRKPQYVKRVR
EMBL CDSAAY79836.1.
Sequence length393 AA
String330779.Saci_0423.
Glycosylation Information
CAZY FamilyNon-GT
EC Number (BRENDA)3.13.1.1
Sugar Donor SpecificityUDP-Glc 
Experimental ValidationIn vivo and In vitro
ProductUDP-sulfoquinovose
Donor SpecificityUDP-Glc
Function in Glycosylation pathway1) It is a UDP-sulfoquinovose synthase, involved in the biosynthesis of UDP-sulfoquinovose by the transfer of sulfite group on UDP-glucose.
Litrature
Year Of Validation2011 
Reference Meyer, B.H., Zolghadr, B., Peyfoon, E., Pabst, M., Panico, M., Morris, H.R., Haslam, S.M., Messner, P., Schäffer, C., Dell, A. & Albers, S. V. (2011). Sulfoquinovose synthase–an important enzyme in the N?glycosylation pathway of Sulfolobus acidocaldarius. Molecular microbiology, 82(5), 1150-1163.

Authors Meyer, B.H., Zolghadr, B., Peyfoon, E., Pabst, M., Panico, M., Morris, H.R., Haslam, S.M., Messner, P., Schäffer, C., Dell, A. & Albers, S. V.
Research groupsMolecular Biology of Archaea, Max-Planck Institute for terrestrial Microbiology, Karl-von-Frisch-Strasse 10, 35043 Marburg.
Corresponding Author Albers, S. V.
ContactsMolecular Biology of Archaea, Max-Planck Institute for Terrestrial Microbiology, Karl-von-Frisch-Strasse 10, 35043 Marburg.